Recombinant Human OSBPL2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human OSBPL2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 294-393 of Human OSBPL2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KLFMIYGKWTECLWGIDPVSYESFKKQERRGDHLRKAKLDEDSGKADSDVADDVPVAQETVQVIPGSKLLWRINTRPPNSAQMYNFTSFTVSLNELETGM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
OSBPL2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OSBPL2 Protein

  • KIAA0772FLJ20223
  • ORP-2MGC4307
  • ORP2MGC8342
  • OSBP-related protein 2
  • oxysterol binding protein-like 2
  • oxysterol-binding protein-like 2
  • oxysterol-binding protein-related protein 2

Background

This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. This encoded protein contains only the sterol-binding domain. In vitro studies have shown that the encoded protein can bind strongly to phosphatic acid and weakly to phosphatidylinositol 3-phosphate, but cannot bind to 25-hydroxycholesterol. The protein associates with the Golgi apparatus. Transcript variants encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00935
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1331
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-46175
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP2-06099
Species: Hu
NBP1-83132
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89112
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81388
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-2448
Species: Hu
Applications: WB, PEP-ELISA
NBL1-11664
Species: Hu
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-32789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for OSBPL2 Partial Recombinant Protein (H00009885-Q01) (0)

There are no publications for OSBPL2 Partial Recombinant Protein (H00009885-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OSBPL2 Partial Recombinant Protein (H00009885-Q01) (0)

There are no reviews for OSBPL2 Partial Recombinant Protein (H00009885-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OSBPL2 Partial Recombinant Protein (H00009885-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OSBPL2 Products

Bioinformatics Tool for OSBPL2 Partial Recombinant Protein (H00009885-Q01)

Discover related pathways, diseases and genes to OSBPL2 Partial Recombinant Protein (H00009885-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OSBPL2 Partial Recombinant Protein (H00009885-Q01)

Discover more about diseases related to OSBPL2 Partial Recombinant Protein (H00009885-Q01).
 

Pathways for OSBPL2 Partial Recombinant Protein (H00009885-Q01)

View related products by pathway.

Blogs on OSBPL2

There are no specific blogs for OSBPL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FoxC2 Antibody
NB100-1269
OSBPL2 Antibody
NBP1-92236
VAP-B Antibody
NBP1-89112

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OSBPL2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol OSBPL2