Recombinant Human OSBPL11 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human OSBPL11 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 649 - 746 of Human OSBPL11 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KYVDLTKLAVTKKRVRPLEKQDPFESRRLWKNVTDSLRESEIDKATEHKHTLEERQRTEERHRTETGTPWKTKYFIKEGDGWVYHKPLWKIIPTTQPA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
OSBPL11

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OSBPL11 Protein

  • FLJ13012
  • FLJ13164
  • ORP11OSBP-related protein 11
  • ORP-11TCCCIA00292
  • OSBP12
  • oxysterol binding protein-like 11
  • oxysterol-binding protein-related protein 11

Background

This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, the encoded protein contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00935
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81054
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19634
Species: Hu
Applications: WB, ICC/IF
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-85954
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81388
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92236
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-31456
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2448
Species: Hu
Applications: WB, PEP-ELISA
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-81403
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00114885-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for OSBPL11 Partial Recombinant Protein (H00114885-Q01) (0)

There are no publications for OSBPL11 Partial Recombinant Protein (H00114885-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OSBPL11 Partial Recombinant Protein (H00114885-Q01) (0)

There are no reviews for OSBPL11 Partial Recombinant Protein (H00114885-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OSBPL11 Partial Recombinant Protein (H00114885-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OSBPL11 Products

Bioinformatics Tool for OSBPL11 Partial Recombinant Protein (H00114885-Q01)

Discover related pathways, diseases and genes to OSBPL11 Partial Recombinant Protein (H00114885-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OSBPL11 Partial Recombinant Protein (H00114885-Q01)

Discover more about diseases related to OSBPL11 Partial Recombinant Protein (H00114885-Q01).

Blogs on OSBPL11

There are no specific blogs for OSBPL11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TGN46 Antibody
NBP1-49643
c-Maf Antibody
NBP2-24551

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OSBPL11 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol OSBPL11