OSBP2 Antibody - BSA Free

Western Blot: OSBP2 Antibody [NBP3-10047] - Western blot analysis of OSBP2 in Human 293T Whole Cell lysates. Antibody dilution at 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

OSBP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit OSBP2 Antibody - BSA Free (NBP3-10047) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OSBP2 (NP_110385.1). Peptide sequence MECSKVMHSSPSSPSSDGKQKTVYQTLSAKLLWKKYPLPENAENMYYFSE
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OSBP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 82 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for OSBP2 Antibody - BSA Free

• ORP4ORP-4KIAA1664Oxysterol-binding protein-related protein 4
• OSBPL1
• OSBPL4
• OSBP-related protein 4
• oxysterol binding protein 2
• oxysterol binding protein-like 1
• oxysterol binding protein-related protein 4
• oxysterol-binding protein 2

Background

Oxysterols are byproducts of cholesterol that can have cytotoxic effects on many cell types. The membrane-bound protein encoded by this gene contains a pleckstrin homology (PH) domain and an oxysterol-binding region. It binds oxysterols such as 7-ketocholesterol and may inhibit their cytotoxicity. Alternate transcriptional splice variants have been observed but have not been fully characterized. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OSBP2