Opsin 3 Antibody

Immunocytochemistry/Immunofluorescence: Opsin 3 Antibody [NBP2-55726] - Staining of human cell line HaCaT shows localization to nucleoplasm. Antibody staining is shown in green.

Product Discontinued

Opsin 3 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQVRPL
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OPN3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse 89%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Opsin 3 Antibody

• ECPN
• ECPNopsin-3
• encephalopsin
• ERO
• NMO-1
• opsin 3 (encephalopsin, panopsin)
• opsin 3
• Panopsin

Background

Opsins, including Encephalopsin, are members of the superfamily of guanine nucleotide-binding protein (G protein)-coupled receptors, which function through the activation of a G protein and an effector enzyme. Opsin proteins consist of a single polypeptide chain of 340 to 500 amino acids that form 7 alpha-helical transmembrane regions connected by cytoplasmic and extracellular loops.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OPN3