OGDH Antibody


Western Blot: OGDH Antibody [NBP1-70663] - This Anti-OGDH antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

OGDH Antibody Summary

Synthetic peptides corresponding to OGDH(oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide)) The peptide sequence was selected from the N terminal of OGDH. Peptide sequence MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against OGDH and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
No Preservative
Immunogen affinity purified
Reconstitution Instructions
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for OGDH Antibody

  • 2-oxoglutarate dehydrogenase complex component E1
  • 2-oxoglutarate dehydrogenase, mitochondrial
  • alpha KGD
  • alpha-KGD
  • E1k
  • OGDC
  • oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide)
  • oxoglutarate decarboxylase
  • oxoglutarate dehydrogenase (succinyl-transferring)


The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO2. It contains multiple copies of three enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).This gene encodes one subunit of the 2-oxoglutarate dehydrogenase complex. This complex catalyzes the overall conversion of 2-oxoglutarate (alpha-ketoglutarate) to succinyl-CoA and CO(2) during the Krebs cycle. The protein is located in the mitocondrial matrix and uses thiamine pyrophosphate as a cofactor. A congential deficiency in 2-oxoglutarate dehydrogenase activity is believed to lead to hypotonia, metabolic acidosis, and hyperlactatemia.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Ca
Applications: WB, Flow
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for OGDH Antibody (NBP1-70663) (0)

There are no publications for OGDH Antibody (NBP1-70663).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OGDH Antibody (NBP1-70663) (0)

There are no reviews for OGDH Antibody (NBP1-70663). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OGDH Antibody (NBP1-70663) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional OGDH Products

Bioinformatics Tool for OGDH Antibody (NBP1-70663)

Discover related pathways, diseases and genes to OGDH Antibody (NBP1-70663). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OGDH Antibody (NBP1-70663)

Discover more about diseases related to OGDH Antibody (NBP1-70663).

Pathways for OGDH Antibody (NBP1-70663)

View related products by pathway.

PTMs for OGDH Antibody (NBP1-70663)

Learn more about PTMs related to OGDH Antibody (NBP1-70663).

Blogs on OGDH

There are no specific blogs for OGDH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our OGDH Antibody and receive a gift card or discount.


Gene Symbol OGDH