Recombinant Human OCTN1/SLC22A4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human OCTN1/SLC22A4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 43-141 of Human SLC22A4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK

Protein/Peptide Type
Partial Recombinant Protein
Gene
SLC22A4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OCTN1/SLC22A4 Protein

  • Ergothioneine transporter
  • ET transporter
  • ETT
  • MGC34546
  • MGC40524
  • OCTN1
  • OCTN1integral membrane transport protein
  • Organic cation/carnitine transporter 1
  • SLC22A4
  • solute carrier family 22 (organic cation/ergothioneine transporter), member 4
  • solute carrier family 22 member 4
  • UT2H

Background

SLC22A4 - solute carrier family 22 (organic cation transporter), member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57222
Species: Hu
Applications: ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-51684
Species: Hu
Applications: WB, ELISA, Flow
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-55619
Species: Hu
Applications: ICC/IF
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-264
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
H00005452-D01P
Species: Hu, Mu, Rt
Applications: WB
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
AF2485
Species: Hu
Applications: WB, IHC, IP
AF7895
Species: Hu
Applications: WB, IHC
NBP2-46466
Species: Hu
Applications: IHC
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NB110-60928
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, EM, IHC, IHC-P

Publications for OCTN1/SLC22A4 Partial Recombinant Protein (H00006583-Q01) (0)

There are no publications for OCTN1/SLC22A4 Partial Recombinant Protein (H00006583-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OCTN1/SLC22A4 Partial Recombinant Protein (H00006583-Q01) (0)

There are no reviews for OCTN1/SLC22A4 Partial Recombinant Protein (H00006583-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OCTN1/SLC22A4 Partial Recombinant Protein (H00006583-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OCTN1/SLC22A4 Products

Bioinformatics Tool for OCTN1/SLC22A4 Partial Recombinant Protein (H00006583-Q01)

Discover related pathways, diseases and genes to OCTN1/SLC22A4 Partial Recombinant Protein (H00006583-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OCTN1/SLC22A4 Partial Recombinant Protein (H00006583-Q01)

Discover more about diseases related to OCTN1/SLC22A4 Partial Recombinant Protein (H00006583-Q01).
 

Pathways for OCTN1/SLC22A4 Partial Recombinant Protein (H00006583-Q01)

View related products by pathway.

PTMs for OCTN1/SLC22A4 Partial Recombinant Protein (H00006583-Q01)

Learn more about PTMs related to OCTN1/SLC22A4 Partial Recombinant Protein (H00006583-Q01).

Blogs on OCTN1/SLC22A4

There are no specific blogs for OCTN1/SLC22A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

OCT4 Antibody
NB100-2379

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OCTN1/SLC22A4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC22A4
Entrez