We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

OAS2 Recombinant Protein Antigen

Images

 
There are currently no images for OAS2 Recombinant Protein Antigen (NBP2-58756PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

OAS2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OAS2.

Source: E. coli

Amino Acid Sequence: TLVLFFSDLKQFQDQKRSQRDILDKTGDKLKFCLFTKWLKNNFEIQKSLDGFTIQVFTKNQRISFEVLAAFNALSLNDNPSPWIYRELKRSLDKTNASPGEFAVCFTELQQK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
OAS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58756.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for OAS2 Recombinant Protein Antigen

  • (2-5')oligo(A) synthase 2
  • (2'-5')oligo(A) synthetase 2
  • (2-5')oligo(A) synthetase 2
  • 2'5' oligoadenylate synthetase 2
  • 2-5A synthase 2
  • 2-5A synthetase 2
  • 2'-5'-oligoadenylate synthase 2
  • 2'-5'-oligoadenylate synthetase 2 (69-71 kD)
  • 2'-5'-oligoadenylate synthetase 2, 69/71kDa
  • EC 2.7.7
  • EC 2.7.7.-
  • MGC78578
  • OAS2
  • p69 OAS / p71 OAS
  • p69OAS / p71OAS

Background

OAS2 encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83122
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-85841
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF5550
Species: Mu, Rt
Applications: WB
NBP2-81833
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-32905
Species: Bv, Hu, Pm, Rb
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-351
Species: Ha, Hu, Mu(-), Pm, Rt(-)
Applications: ELISA, IHC,  IHC-P, KO, WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB1980
Species: Hu
Applications: ICC, IP, Simple Western, WB
AF8519
Species: Hu, Mu, Rt
Applications: Simple Western, WB
NBP2-16991
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
DIP100
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
H00005706-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
485-MI
Species: Mu
Applications: BA
H00008814-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
375-TL
Species: Hu
Applications: BA
NBP1-88792
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-67634
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB

Publications for OAS2 Recombinant Protein Antigen (NBP2-58756PEP) (0)

There are no publications for OAS2 Recombinant Protein Antigen (NBP2-58756PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OAS2 Recombinant Protein Antigen (NBP2-58756PEP) (0)

There are no reviews for OAS2 Recombinant Protein Antigen (NBP2-58756PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for OAS2 Recombinant Protein Antigen (NBP2-58756PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OAS2 Products

Blogs on OAS2.

COVID-19 and metabolic dysregulation: SARS-CoV-2 injures human exocrine and endocrine pancreas
Jamshed Arslan, Pharm D, PhD Humans rely on the pancreas for digesting food and generating energy from it. SARS-CoV-2-mediated damage to the exocrine pancreas is evident from the pancreatitis, pancreatic enlargeme...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our OAS2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol OAS2