NXT2 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: NXT2 Antibody [NBP2-58002] - Staining of human cell line SiHa shows localization to nucleoplasm & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

NXT2 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit NXT2 Antibody - BSA Free (NBP2-58002) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KYRSHWSQGDREGYQRRSNYYEGPHTSHSSPADRTREEVVTPTLPEHTATRSQMATSLD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NXT2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NXT2 Recombinant Protein Antigen (NBP2-58002PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NXT2 Antibody - BSA Free

  • BM-025
  • NTF2-related export protein 2
  • nuclear transport factor 2-like export factor 2
  • protein p15-2

Background

Regulator of protein export for NES-containing proteins. Also plays a role in mRNA nuclear export

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00029107-M08
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NBP1-31649
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-38209
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-90286
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83213
Species: Hu
Applications: IHC,  IHC-P, WB
H00056000-M06
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP1-85809
Species: Hu
Applications: IHC,  IHC-P
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB5018
Species: Hu
Applications: IP, WB
AF2538
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-01346
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-38014
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00008398-D01P
Species: Hu, Mu
Applications: WB
MAB2669
Species: Hu
Applications: IHC, Simple Western, WB
NBP3-08571
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PA
H00151056-B01P
Species: Hu, Mu
Applications: WB
NBP2-33897
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-12671
Species: Hu
Applications: ICC/IF,  IHC-P, IP, WB
NBP1-91928
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for NXT2 Antibody (NBP2-58002) (0)

There are no publications for NXT2 Antibody (NBP2-58002).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NXT2 Antibody (NBP2-58002) (0)

There are no reviews for NXT2 Antibody (NBP2-58002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NXT2 Antibody (NBP2-58002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NXT2 Products

Research Areas for NXT2 Antibody (NBP2-58002)

Find related products by research area.

Blogs on NXT2

There are no specific blogs for NXT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NXT2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol NXT2