NUDT4 Antibody


Western Blot: NUDT4 Antibody [NBP1-84250] - Analysis in human cell lines Caco-2 and HeLa using anti-NUDT4 antibody. Corresponding NUDT4 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunohistochemistry-Paraffin: NUDT4 Antibody [NBP1-84250] - Staining of human small intestine shows cytoplasmic positivity with a granular pattern in the glandular cells.
Western Blot: NUDT4 Antibody [NBP1-84250] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: NUDT4 Antibody [NBP1-84250] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-401

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

NUDT4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR
Specificity of human, mouse, rat NUDT4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NUDT4 Protein (NBP1-84250PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NUDT4 Antibody

  • Diadenosine 5'-5'''-P1
  • diphosphoinositol polyphosphate phosphohydrolase 2
  • diphosphoinositol polyphosphate phosphohydrolase type 2
  • DIPP-2
  • DIPP2alpha
  • DIPP2beta
  • EC 3.6.1.-
  • EC
  • KIAA0487DKFZp686I1281
  • Nucleoside diphosphate-linked moiety X motif 4
  • nudix (nucleoside diphosphate linked moiety X)-type motif 4
  • Nudix motif 4
  • P6-hexaphosphate hydrolase 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for NUDT4 Antibody (NBP1-84250) (0)

There are no publications for NUDT4 Antibody (NBP1-84250).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUDT4 Antibody (NBP1-84250) (0)

There are no reviews for NUDT4 Antibody (NBP1-84250). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUDT4 Antibody (NBP1-84250) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NUDT4 Products

Bioinformatics Tool for NUDT4 Antibody (NBP1-84250)

Discover related pathways, diseases and genes to NUDT4 Antibody (NBP1-84250). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for NUDT4 Antibody (NBP1-84250)

Find related products by research area.

Blogs on NUDT4

There are no specific blogs for NUDT4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NUDT4 Antibody and receive a gift card or discount.


Gene Symbol NUDT4