NUDT4 Antibody

Images

 
Western Blot: NUDT4 Antibody [NBP1-84250] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: NUDT4 Antibody [NBP1-84250] - Staining of human small intestine shows cytoplasmic positivity with a granular pattern in the glandular cells.
Western Blot: NUDT4 Antibody [NBP1-84250] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-401

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NUDT4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUDT4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NUDT4 Protein (NBP1-84250PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NUDT4 Antibody

  • Diadenosine 5'-5'''-P1
  • diphosphoinositol polyphosphate phosphohydrolase 2
  • diphosphoinositol polyphosphate phosphohydrolase type 2
  • DIPP-2
  • DIPP2alpha
  • DIPP2beta
  • DIPP2HDCMB47P
  • EC 3.6.1.-
  • EC 3.6.1.52
  • KIAA0487DKFZp686I1281
  • Nucleoside diphosphate-linked moiety X motif 4
  • nudix (nucleoside diphosphate linked moiety X)-type motif 4
  • Nudix motif 4
  • P6-hexaphosphate hydrolase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15048
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84288
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37412
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-83131
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84250
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for NUDT4 Antibody (NBP1-84250) (0)

There are no publications for NUDT4 Antibody (NBP1-84250).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUDT4 Antibody (NBP1-84250) (0)

There are no reviews for NUDT4 Antibody (NBP1-84250). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUDT4 Antibody (NBP1-84250) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NUDT4 Products

Bioinformatics Tool for NUDT4 Antibody (NBP1-84250)

Discover related pathways, diseases and genes to NUDT4 Antibody (NBP1-84250). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for NUDT4 Antibody (NBP1-84250)

Find related products by research area.

Blogs on NUDT4

There are no specific blogs for NUDT4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUDT4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUDT4