Nucleoplasmin-3 Antibody - Azide and BSA Free

Western Blot: Nucleoplasmin-3 Antibody [NBP3-15545] - Western blot analysis of extracts of various cell lines, using Nucleoplasmin-3 Rabbit pAb (NBP3-15545) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Nucleoplasmin-3 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit Nucleoplasmin-3 Antibody - Azide and BSA Free (NBP3-15545) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-140 of human Nucleoplasmin-3 (NP_008924.1). APVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NPM3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for Nucleoplasmin-3 Antibody - Azide and BSA Free

• nucleophosmin/nucleoplasmin 3
• nucleophosmin/nucleoplasmin family, member 3
• nucleoplasmin-3
• PORMIN
• TMEM123

Background

Nucleoplasmin-3 is encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. This protein is strongly expressed in diverse cell types where it localizes primarily to the nucleus. Based on its similarity to nucleoplasmin and nucleophosmin, this protein likely functions as a molecular chaperone in the cell nucleus. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: NPM3