Recombinant Human NTPCR Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NTPCR Protein Summary

Description
NTPCR (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
NTPCR

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NTPCR Protein

  • C1orf57
  • chromosome 1 open reading frame 57
  • EC 3.6.1.15
  • FLJ11383
  • HCR-NTPase
  • human cancer-related NTPase
  • MGC13186
  • NTPase
  • Nucleoside triphosphate phosphohydrolase
  • nucleoside-triphosphatase C1orf57
  • nucleoside-triphosphatase, cancer-related
  • RP4-678E16.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-32870
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-87003
Species: Hu, Rt
Applications: WB, IP, PLA
NBP1-59599
Species: Hu, Rt
Applications: WB
NBP1-59662
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-69571
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-57614
Species: Hu
Applications: ICC/IF
NB100-74635
Species: Hu
Applications: WB (-), WB, ICC/IF, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF

Publications for NTPCR Recombinant Protein (H00084284-P01) (0)

There are no publications for NTPCR Recombinant Protein (H00084284-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NTPCR Recombinant Protein (H00084284-P01) (0)

There are no reviews for NTPCR Recombinant Protein (H00084284-P01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NTPCR Recombinant Protein (H00084284-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human NTPCR Protein Products

Related Products by Gene

Bioinformatics Tool for NTPCR Recombinant Protein (H00084284-P01)

Discover related pathways, diseases and genes to NTPCR Recombinant Protein (H00084284-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for NTPCR Recombinant Protein (H00084284-P01)

Find related products by research area.

Blogs on NTPCR

There are no specific blogs for NTPCR, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NTPCR Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NTPCR

Customers Who Bought This Also Bought

NTPCR Antibody
NBP1-88331
NTPCR Antibody
NBP1-88331
NTPCR Antibody
NBP1-88331