Recombinant Human NTPCR Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NTPCR Protein Summary

Description
NTPCR (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
NTPCR

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NTPCR Protein

  • C1orf57
  • chromosome 1 open reading frame 57
  • EC 3.6.1.15
  • FLJ11383
  • HCR-NTPase
  • human cancer-related NTPase
  • MGC13186
  • NTPase
  • Nucleoside triphosphate phosphohydrolase
  • nucleoside-triphosphatase C1orf57
  • nucleoside-triphosphatase, cancer-related
  • RP4-678E16.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB100-87003
Species: Hu, Rt
Applications: WB, IP, PLA
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-59662
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF

Publications for NTPCR Recombinant Protein (H00084284-P01) (0)

There are no publications for NTPCR Recombinant Protein (H00084284-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NTPCR Recombinant Protein (H00084284-P01) (0)

There are no reviews for NTPCR Recombinant Protein (H00084284-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NTPCR Recombinant Protein (H00084284-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NTPCR Products

Bioinformatics Tool for NTPCR Recombinant Protein (H00084284-P01)

Discover related pathways, diseases and genes to NTPCR Recombinant Protein (H00084284-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for NTPCR Recombinant Protein (H00084284-P01)

Find related products by research area.

Blogs on NTPCR

There are no specific blogs for NTPCR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NTPCR Antibody
NBP1-88331
NTPCR Antibody
NBP1-88331

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NTPCR Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NTPCR