NTPCR Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

NTPCR Recombinant Protein Summary

Description
NTPCR (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Gene
NTPCR

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NTPCR Recombinant Protein

  • C1orf57
  • chromosome 1 open reading frame 57
  • EC 3.6.1.15
  • FLJ11383
  • HCR-NTPase
  • human cancer-related NTPase
  • MGC13186
  • NTPase
  • Nucleoside triphosphate phosphohydrolase
  • nucleoside-triphosphatase C1orf57
  • nucleoside-triphosphatase, cancer-related
  • RP4-678E16.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-32870
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-87003
Species: Hu, Rt
Applications: WB, IP, PLA
NBP1-59599
Species: Hu, Rt
Applications: WB
NBP1-59662
Species: Hu
Applications: WB, IHC, IHC-P
H00008706-T01
Species: Hu
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-69571
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-62583
Species: Hu
Applications: WB
NB100-74635
Species: Hu
Applications: WB (-), ICC/IF, IHC, IHC-P, IP
NBP2-33688
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NTPCR Recombinant Protein (H00084284-P01) (0)

There are no publications for NTPCR Recombinant Protein (H00084284-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NTPCR Recombinant Protein (H00084284-P01) (0)

There are no reviews for NTPCR Recombinant Protein (H00084284-P01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NTPCR Recombinant Protein (H00084284-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NTPCR Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for NTPCR Recombinant Protein (H00084284-P01)

Discover related pathways, diseases and genes to NTPCR Recombinant Protein (H00084284-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for NTPCR Recombinant Protein (H00084284-P01)

Find related products by research area.

Blogs on NTPCR

There are no specific blogs for NTPCR, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol NTPCR

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00084284-P01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

NTPCR Antibody
NBP1-88331
NTPCR Antibody
NBP1-88331
NTPCR Antibody
NBP1-88331