Recombinant Human NTF2 Protein

Product Discontinued

Recombinant Human NTF2 Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-127 of Human NUTF2 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein is not active and should not be used for experiments requiring activity.
• Protein/Peptide Type: Recombinant Protein
• Gene: NUTF2

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NTF2 Protein

• NTF-2
• NTF2PP15Placental protein 15
• nuclear transport factor 2

Background

NUTF2( AAH02348, 1 a.a. - 128 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NUTF2