NSP 5 alpha 3 alpha Antibody - BSA Free

Western Blot: NSP 5 alpha 3 alpha Antibody [NBP3-09409] - Western blot analysis of NSP 5 alpha 3 alpha in HepG2 Whole Cell as a positive control. Antibody dilution at 1.0 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NSP 5 alpha 3 alpha Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NSP 5 alpha 3 alpha (NP_690868). Peptide sequence RTPSTKPKQENEGGEKAALESQVRELLAEAKAKDSEINRLRSELKKYKEK
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPECC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 87 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NSP 5 alpha 3 alpha Antibody - BSA Free

• cytospin-B
• CYTSBcytospin B
• FLJ36955
• HCMOGT-1
• NSP
• NSP5
• Nuclear structure protein 5
• sperm antigen HCMOGT 1
• Sperm antigen HCMOGT-1
• sperm antigen with calponin homology and coiled coil domains 1
• sperm antigen with calponin homology and coiled-coil domains 1cytokinesis and spindle organization B
• sperm antigen with calponin-like and coiled coil domains 1
• structure protein NSP5a3a
• structure protein NSP5a3b
• structure protein NSP5b3a
• structure protein NSP5b3b

Background

NSP 5alpha 3alpha is a novel structure protein with potential roles in ribosome biogenesis and rRNA metabolism/processing. NSP5a3a is highly expressed in certain tumor cell lines, and may serve as a good tumor marker. In these cancer lines, NSP5a3a has been shown to interact with the nucleolar apoptosis protein B23 and may be involved in a novel p73 dependent apoptosis mechanism. Therefore, NSP5a3a is expected to become an important potential target for future cancer treatment research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPECC1