NRK1 Antibody (2A10) - Azide and BSA Free

Immunoprecipitation: NRK1 Antibody (2A10) [H00054981-M01] - Analysis of C9orf95 transfected lysate using anti-C9orf95 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with C9orf95 MaxPab rabbit polyclonal antibody.

ELISA: NRK1 Antibody (2A10) [H00054981-M01] - Detection limit for recombinant GST tagged C9orf95 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IP
• Clone: 2A10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NRK1 Antibody (2A10) - Azide and BSA Free Summary

• Immunogen: C9orf95 (NP_060351.1, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAE
• Specificity: Reacts with chromosome 9 open reading frame 95.
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NMRK1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NRK1 Antibody (2A10) - Azide and BSA Free

• bA235O14.2
• C9orf95
• cDNA FLJ39825
• EC 2.7.1.173
• EC 2.7.1.22
• EC 2.7.1.n4
• FLJ20559
• nicotinamide riboside kinase 1
• Nicotinic acid riboside kinase 1
• NmR-K 1
• NMRK1
• NRK 1
• NRK1
• Ribosylnicotinamide kinase 1
• Ribosylnicotinic acid kinase 1
• RNK 1

Background

Nicotinamide adenine dinucleotide (NAD+) is essential for life in all organisms, both as a coenzyme for oxidoreductases and as a source of ADP-ribosyl groups used in various reactions. Nicotinic acid and nicotinamide, collectively known as niacin, are the vitamin precursors of NAD+. Nicotinamide riboside kinases, such as NRK1, function to synthesize NAD+ through nicotinamide mononucleotide using nicotinamide riboside as the precursor (Bieganowski and Brenner, 2004 [PubMed 15137942]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NMRK1
• Entrez:
  • 54981(Human)
• Uniprot:
  • NP_060351(Human)