We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

NPRA/NPR1 Recombinant Protein Antigen

Images

 
There are currently no images for NPRA/NPR1 Recombinant Protein Antigen (NBP1-90164PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NPRA/NPR1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NPR-1/Natriuretic Peptide Receptor A.

Source: E. coli

Amino Acid Sequence: FHLDIFGQSLQGGQGPAPRRPWERGDGQDVSARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLYIQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NPR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90164.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NPRA/NPR1 Recombinant Protein Antigen

  • ANPa
  • ANP-A
  • ANPRA
  • ANPR-A
  • ANPRAEC 4.6.1.2
  • atrial natriuretic peptide receptor 1
  • Atrial natriuretic peptide receptor type A
  • atrionatriuretic peptide receptor A
  • GC-A
  • Guanylate cyclase A
  • GUC2A
  • GUCY2A
  • natriuretic peptide A type receptor
  • natriuretic peptide receptor A
  • natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptidereceptor A)
  • NPR1
  • NPRA
  • NPR-A
  • Pndr

Background

Guanylyl cyclases, catalyzing the production of cGMP from GTP, are classified as soluble and membrane forms (Garbers and Lowe, 1994 (PubMed 7982997)). The membrane guanylyl cyclases, often termed guanylyl cyclases A through F, form a family of cell-surface receptors with a similar topographic structure: an extracellular ligand-binding domain, a single membrane-spanning domain, and an intracellular region that contains a protein kinase-like domain and a cyclase catalytic domain. GC-A and GC-B function as receptors for natriuretic peptides; they are also referred to as atrial natriuretic peptide receptor A (NPR1) and type B (NPR2; MIM 108961). Also see NPR3 (MIM 108962), which encodes a protein with only the ligand-binding transmembrane and 37-amino acid cytoplasmic domains. NPR1 is a membrane-bound guanylate cyclase that serves as the receptor for both atrial and brain natriuretic peptides (ANP (MIM 108780) and BNP (MIM 600295), respectively).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3366
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP3-15718
Species: Mu
Applications: ELISA, WB
NBP2-02401
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-46201
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-50031
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-46388
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF4414
Species: Hu
Applications: IHC, Simple Western, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89090
Species: Hu
Applications: IHC,  IHC-P
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
NBP1-90164PEP
Species: Hu
Applications: AC

Publications for NPRA/NPR1 Recombinant Protein Antigen (NBP1-90164PEP) (0)

There are no publications for NPRA/NPR1 Recombinant Protein Antigen (NBP1-90164PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NPRA/NPR1 Recombinant Protein Antigen (NBP1-90164PEP) (0)

There are no reviews for NPRA/NPR1 Recombinant Protein Antigen (NBP1-90164PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NPRA/NPR1 Recombinant Protein Antigen (NBP1-90164PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NPRA/NPR1 Products

Research Areas for NPRA/NPR1 Recombinant Protein Antigen (NBP1-90164PEP)

Find related products by research area.

Blogs on NPRA/NPR1

There are no specific blogs for NPRA/NPR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NPRA/NPR1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NPR1