NPM1 Antibody (1B11)

Images

 
Immunocytochemistry/ Immunofluorescence: NPM1 Antibody (1B11) [H00004869-M02] - Analysis of monoclonal antibody to NPM1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: NPM1 Antibody (1B11) [H00004869-M02] - Detection limit for recombinant GST tagged NPM1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1B11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NPM1 Antibody (1B11) Summary

Immunogen
NPM1 (AAH02398.1, 1 a.a. - 294 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NPM1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NPM1 Antibody (1B11)

  • B23
  • MGC104254
  • NPM1
  • NPMnucleophosmin/nucleoplasmin family, member 1
  • Nucleolar phosphoprotein B23
  • Nucleolar protein NO38
  • nucleophosmin (nucleolar phosphoprotein B23, numatrin)
  • Nucleophosmin
  • Numatrin

Background

The CD246 antigen, or ALK (Anaplastic Lymphoma Kinase; neural tyrosine kinase) is a 200 kDa transmembrane molecule expressed only in neural tissues (weakly) and by the rhabdomyosarcoma Rh30 cell line. The alk gene is on chromosome 2. Upon translocation between chromosome 2 and chromosome 5 [t(2;5)], the alk gene fuses with the npm gene. NPM, also known as nucleophosmin or B23, is an ubiquitous nucleolar phosphoprotein involved in the transport of pre-ribosomal components between the nucleolus and the cytoplasm. The chimeric product resulting from t(2;5) translocation is a protein of 80 kDa with the N-terminal portion of NPM linked to the complete intracellular portion of ALK. Karpas 299 and SU-DHL-1 lymphoid cell lines strongly express NPM-ALK.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF4210
Species: Hu
Applications: WB, IHC
NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-P, IM
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-1438
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
MAB4648
Species: Hu, Mu, Rt
Applications: WB, ICC
AF7250
Species: Hu
Applications: IHC
NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
NB100-56161
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB300-269
Species: Hu, Mu, Rt, Ce, Ch, Dr, Pl, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP2-46157
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47804
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
H00004869-M02
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for NPM1 Antibody (H00004869-M02) (0)

There are no publications for NPM1 Antibody (H00004869-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NPM1 Antibody (H00004869-M02) (0)

There are no reviews for NPM1 Antibody (H00004869-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NPM1 Antibody (H00004869-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NPM1 Products

Bioinformatics Tool for NPM1 Antibody (H00004869-M02)

Discover related pathways, diseases and genes to NPM1 Antibody (H00004869-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPM1 Antibody (H00004869-M02)

Discover more about diseases related to NPM1 Antibody (H00004869-M02).
 

Pathways for NPM1 Antibody (H00004869-M02)

View related products by pathway.

PTMs for NPM1 Antibody (H00004869-M02)

Learn more about PTMs related to NPM1 Antibody (H00004869-M02).
 

Research Areas for NPM1 Antibody (H00004869-M02)

Find related products by research area.

Blogs on NPM1

There are no specific blogs for NPM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NPM1 Antibody (1B11) and receive a gift card or discount.

Bioinformatics

Gene Symbol NPM1
Entrez
Uniprot