NPAP1 Antibody

Images

 
Immunohistochemistry: NPAP1 Antibody [NBP2-14377] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NPAP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: TSVITSKPMNSTSVISTVTTNASAHLTSQTAVDPEVVNMDTTAPSQVVIFTSSLSSRVSSLPNSQIHCSAEQRHPGKTSVYTSPLPFIFHNTTPSFNQLFGKEATPQPKFEAPDGQPQKASLPSA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NPAP1 Protein (NBP2-14377PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NPAP1 Antibody

  • C15orf2
  • chromosome 15 open reading frame 2
  • protein C15orf2

Background

C15orf2 may be involved in spermatogenesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004692-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP2-20439
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-09393
Species: Hu
Applications: WB
H00006047-A01
Species: Hu
Applications: ELISA, IP, WB
NB400-148
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
H00022932-M02
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-81964
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-76764
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-481
Species: Hu
Applications: ChIP, IHC, IHC-Fr, IHC-P, IP, WB
H00008926-B01P
Species: Hu
Applications: ICC/IF, WB
H00007337-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
NBP2-53210
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF674
Species: Hu
Applications: Neut, Simple Western, WB
NBP2-14377
Species: Hu
Applications: IHC

Publications for NPAP1 Antibody (NBP2-14377) (0)

There are no publications for NPAP1 Antibody (NBP2-14377).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NPAP1 Antibody (NBP2-14377) (0)

There are no reviews for NPAP1 Antibody (NBP2-14377). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NPAP1 Antibody (NBP2-14377) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NPAP1 Products

Diseases for NPAP1 Antibody (NBP2-14377)

Discover more about diseases related to NPAP1 Antibody (NBP2-14377).

Blogs on NPAP1

There are no specific blogs for NPAP1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NPAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPAP1