Nova1 Antibody

Images

 
Western Blot: Nova1 Antibody [NBP1-57397] - Hela cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Nova1 Antibody [NBP1-57397] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nova1 Antibody Summary

Immunogen
Synthetic peptides corresponding to NOVA1(neuro-oncological ventral antigen 1) The peptide sequence was selected from the C terminal of NOVA1. Peptide sequence SKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOVA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against NOVA1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Nova1 Antibody

  • neuro-oncological ventral antigen 1Nova-1
  • Onconeural ventral antigen 1
  • Paraneoplastic Ri antigen
  • RNA-binding protein Nova-1
  • Ventral neuron-specific protein 1

Background

NOVA1 is a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer.This gene encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. Alternatively spliced transcripts encoding distinct isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001996-M01
Species: Hu, Rt
Applications: WB, ELISA, IHC-P, RNAi
NBP1-92196
Species: Hu
Applications: IHC, IHC-P
NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-58345
Species: Hu, Mu, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-314
Species: Hu, Mu, Rt, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00001813-M01A
Species: Hu
Applications: WB, ELISA
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-87561
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90821
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57397
Species: Hu
Applications: WB

Publications for Nova1 Antibody (NBP1-57397) (0)

There are no publications for Nova1 Antibody (NBP1-57397).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nova1 Antibody (NBP1-57397) (0)

There are no reviews for Nova1 Antibody (NBP1-57397). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nova1 Antibody (NBP1-57397) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Nova1 Antibody (NBP1-57397)

Discover related pathways, diseases and genes to Nova1 Antibody (NBP1-57397). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nova1 Antibody (NBP1-57397)

Discover more about diseases related to Nova1 Antibody (NBP1-57397).
 

Pathways for Nova1 Antibody (NBP1-57397)

View related products by pathway.

PTMs for Nova1 Antibody (NBP1-57397)

Learn more about PTMs related to Nova1 Antibody (NBP1-57397).

Blogs on Nova1

There are no specific blogs for Nova1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nova1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NOVA1
Uniprot