Recombinant Human NORE1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NORE1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 100-206 of Human RASSF5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DVRSIFEQPQDPRVPAERGEGHCFAELVLPGGPGWCDLCGREVLRQALRCTNCKFTCHPECRSLIQLDCSQQEGLSRDRPSPESTLTVTFSQNVCKPVEETQRPPTL

Protein/Peptide Type
Partial Recombinant Protein
Gene
RASSF5

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NORE1 Protein

  • Maxp1
  • MGC10823
  • MGC17344
  • New ras effector 1
  • NORE1A
  • NORE1B
  • NORE1RASSF3
  • Rap1-binding protein
  • RAPLnovel Ras effector 1
  • Ras association (RalGDS/AF-6) domain family 5
  • Ras association (RalGDS/AF-6) domain family member 5
  • ras association domain-containing protein 5
  • Ras effector-like protein
  • regulator for cell adhesion and polarization enriched in lymphoid tissue
  • Regulator for cell adhesion and polarization enriched in lymphoid tissues
  • tumor suppressor RASSF3

Background

RASSF5 - Ras association (RalGDS/AF-6) domain family 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00006789-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PLA
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-48017
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP1-89249
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-89958
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5639
Species: Hu, Mu
Applications: WB, ICC
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20163
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00083593-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for NORE1 Partial Recombinant Protein (H00083593-Q01) (0)

There are no publications for NORE1 Partial Recombinant Protein (H00083593-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NORE1 Partial Recombinant Protein (H00083593-Q01) (0)

There are no reviews for NORE1 Partial Recombinant Protein (H00083593-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NORE1 Partial Recombinant Protein (H00083593-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NORE1 Products

Bioinformatics Tool for NORE1 Partial Recombinant Protein (H00083593-Q01)

Discover related pathways, diseases and genes to NORE1 Partial Recombinant Protein (H00083593-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NORE1 Partial Recombinant Protein (H00083593-Q01)

Discover more about diseases related to NORE1 Partial Recombinant Protein (H00083593-Q01).
 

Pathways for NORE1 Partial Recombinant Protein (H00083593-Q01)

View related products by pathway.

PTMs for NORE1 Partial Recombinant Protein (H00083593-Q01)

Learn more about PTMs related to NORE1 Partial Recombinant Protein (H00083593-Q01).
 

Research Areas for NORE1 Partial Recombinant Protein (H00083593-Q01)

Find related products by research area.

Blogs on NORE1

There are no specific blogs for NORE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
NORE1 Antibody
NB500-248

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NORE1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RASSF5