non-muscle heavy chain 10 Myosin Antibody - BSA Free

Western Blot: non-muscle heavy chain 10 Myosin Antibody [NBP1-55146] - Titration: 0.2-1 ug/ml, Positive Control: Human Lung.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

non-muscle heavy chain 10 Myosin Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to MYH10(myosin, heavy chain 10, non-muscle) The peptide sequence was selected from the N terminal of MYH10. Peptide sequence WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYH10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 229 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for non-muscle heavy chain 10 Myosin Antibody - BSA Free

• cellular myosin heavy chain, type B type B
• Cellular myosin heavy chain, type B
• heavy polypeptide 10, non-muscle
• MGC134913
• MGC134914
• MYH10
• Myosin heavy chain 10
• Myosin heavy chain, non-muscle IIb
• myosin heavy chain, nonmuscle type B
• myosin, heavy chain 10, non-muscle
• myosin-10
• near to the ATP binding region
• NMMHC II-b
• NMMHCB
• NMMHC-B
• NMMHC-IIB
• non-muscle heavy chain 10 Myosin
• Non-muscle myosin heavy chain B
• nonmuscle myosin heavy chain IIB
• Non-muscle myosin heavy chain IIb
• nonmuscle myosin heavy chain-B
• nonmuscle myosin II heavy chain-B

Background

MYH10 is the cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYH10
• Uniprot:
  • P35580(Human)