NOLC1 Antibody (6B4)

Images

 
Western Blot: NOLC1 Antibody (6B4) [H00009221-M02] - NOLC1 monoclonal antibody (M02), clone 6B4 Analysis of NOLC1 expression in HepG2.
Immunohistochemistry-Paraffin: NOLC1 Antibody (6B4) [H00009221-M02] - Analysis of monoclonal antibody to NOLC1 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 1.5 ug/ml.
Sandwich ELISA: NOLC1 Antibody (6B4) [H00009221-M02] - Detection limit for recombinant GST tagged NOLC1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC
Clone
6B4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NOLC1 Antibody (6B4) Summary

Immunogen
NOLC1 (NP_004732, 590 a.a. ~ 699 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSIKFDSE
Specificity
NOLC1 (6B4)
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NOLC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NOLC1 Antibody (6B4)

  • 140 kDa nucleolar phosphoprotein
  • HCV NS5A trans-regulated protein 13
  • HCV NS5A-transactivated protein 13
  • Hepatitis C virus NS5A-transactivated protein 13
  • KIAA0035NS5ATP13
  • NOPP130
  • NOPP140
  • Nucleolar 130 kDa protein
  • nucleolar and coiled-body phosphoprotein 1
  • nucleolar and coiled-body phosphprotein 1
  • Nucleolar phosphoprotein p130
  • nucleolar protein p130
  • P130

Background

NOPP140 (140 kDa nucleolar phosphoprotein) is implicated to play a role in ribosome assembly and the regulation of rRNA transcription. It has been observed to shuttle between the nucleus and cytoplasm and may also be important to nucleolar structural organization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33735
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56598
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
NBP1-82455
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00532
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-21374
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
AF4467
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00001434-M08
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB600-210
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-26616
Species: Hu
Applications: IP, WB
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-24459
Species: Ca, Ch, Hu, Mu, Pm, Rb, Rt, RM, Xp, Ze
Applications: ICC/IF, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF1555
Species: Hu
Applications: WB
NBP2-46085
Species: Hu
Applications: IHC, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
H00009221-M02
Species: Hu
Applications: WB, ELISA, IHC

Publications for NOLC1 Antibody (H00009221-M02) (0)

There are no publications for NOLC1 Antibody (H00009221-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOLC1 Antibody (H00009221-M02) (0)

There are no reviews for NOLC1 Antibody (H00009221-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NOLC1 Antibody (H00009221-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NOLC1 Products

Diseases for NOLC1 Antibody (H00009221-M02)

Discover more about diseases related to NOLC1 Antibody (H00009221-M02).
 

Pathways for NOLC1 Antibody (H00009221-M02)

View related products by pathway.

PTMs for NOLC1 Antibody (H00009221-M02)

Learn more about PTMs related to NOLC1 Antibody (H00009221-M02).
 

Research Areas for NOLC1 Antibody (H00009221-M02)

Find related products by research area.

Blogs on NOLC1

There are no specific blogs for NOLC1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOLC1 Antibody (6B4) and receive a gift card or discount.

Bioinformatics

Gene Symbol NOLC1
Entrez
OMIM
Uniprot