NOLA1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

NOLA1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GAR1.
  
  

  Source: E. coli

  Amino Acid Sequence: GRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTT

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: GAR1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31742.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 22 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NOLA1 Recombinant Protein Antigen

• GAR1 ribonucleoprotein homolog (yeast)
• H/ACA ribonucleoprotein complex subunit 1
• NOLA1member 1 (H/ACA small nucleolar RNPs)
• Nucleolar protein family A member 1
• snoRNP protein GAR1

Background

Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex. which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5. instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ("psi") residues. which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC. the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: GAR1