Recombinant Human Nogo B receptor Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Nogo B receptor Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 293 of Human NUS1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTGLYELVWRVLHALLCLHRTLTSWLRVRFGTWNWIWRRCCRAASAAVLAPLGFTLRKPPAVGRNRRHHRHPRGGSCLAAAHHRMRWRADGRSLEKLPVHMGLVITEVEQEPSFSDIASLVVWCMAVGISYISVYDHQGIFKRNNSRLMDEILKQQQELLGLDCSKYSPEFANSNDKDDQVLNCHLAVKVLSPEDGKADIVRAAQDFCQLVAQKQKRPTDLDVDTLASLLSSNGCPDPDLVLKFGPVDSTLGFLPWHIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
NUS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
59.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Nogo B receptor Protein

  • C6orf68MGC117249
  • chromosome 6 open reading frame 68
  • MGC:7199
  • MGC7199
  • NgBR
  • nogo-B receptor
  • nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae)
  • Nuclear undecaprenyl pyrophosphate synthase 1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84012
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56681
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC-P
NBP1-84975
Species: Hu
Applications: IHC, IHC-P
AF1440
Species: Mu
Applications: WB
NBP1-31475
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1936
Species: Hu
Applications: WB, IP
NBP2-36777
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-16984
Species: Hu
Applications: WB, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-89019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
MAB9350
Species: Hu
Applications: WB, IHC, IHC-P
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
8457-AS
Species: Hu
NBP2-54730
Species: Hu
Applications: IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86635
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00116150-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Nogo B receptor Recombinant Protein (H00116150-P01) (0)

There are no publications for Nogo B receptor Recombinant Protein (H00116150-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nogo B receptor Recombinant Protein (H00116150-P01) (0)

There are no reviews for Nogo B receptor Recombinant Protein (H00116150-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nogo B receptor Recombinant Protein (H00116150-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nogo B receptor Products

Bioinformatics Tool for Nogo B receptor Recombinant Protein (H00116150-P01)

Discover related pathways, diseases and genes to Nogo B receptor Recombinant Protein (H00116150-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nogo B receptor Recombinant Protein (H00116150-P01)

Discover more about diseases related to Nogo B receptor Recombinant Protein (H00116150-P01).
 

Pathways for Nogo B receptor Recombinant Protein (H00116150-P01)

View related products by pathway.

PTMs for Nogo B receptor Recombinant Protein (H00116150-P01)

Learn more about PTMs related to Nogo B receptor Recombinant Protein (H00116150-P01).
 

Research Areas for Nogo B receptor Recombinant Protein (H00116150-P01)

Find related products by research area.

Blogs on Nogo B receptor

There are no specific blogs for Nogo B receptor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Nogo B receptor Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NUS1