Nogo B receptor Antibody - BSA Free

Western Blot: Nogo B receptor Antibody [NBP2-85390] - Host: Rabbit. Target Name: NUS1. Sample Tissue: Human 293T Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Discontinued

Nogo B receptor Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Nogo B receptor Antibody - BSA Free (NBP2-85390) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human Nogo B receptor. Peptide sequence: SRLMDEILKQQQELLGLDCSKYSPEFANSNDKDDQVLNCHLAVKVLSPED The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Nogo B receptor Antibody - BSA Free

• C6orf68MGC117249
• chromosome 6 open reading frame 68
• MGC:7199
• MGC7199
• NgBR
• nogo-B receptor
• nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae)
• Nuclear undecaprenyl pyrophosphate synthase 1 homolog

Background

Nogo B receptor acts as a specific receptor for the N-terminus of Nogo-B, a neural and cardiovascular regulator. Able toregulate vascular remodeling and angiogenesis. Its similarity with UPP synthetase proteins suggests that it may act asa scaffold for the binding of iso

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NUS1