Nogo B receptor Antibody

Images

 
Western Blot: Nogo B receptor Antibody [NBP2-85390] - Host: Rabbit. Target Name: NUS1. Sample Tissue: Human 293T Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nogo B receptor Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human Nogo B receptor. Peptide sequence: SRLMDEILKQQQELLGLDCSKYSPEFANSNDKDDQVLNCHLAVKVLSPED The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
NUS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nogo B receptor Antibody

  • C6orf68MGC117249
  • chromosome 6 open reading frame 68
  • MGC:7199
  • MGC7199
  • NgBR
  • nogo-B receptor
  • nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae)
  • Nuclear undecaprenyl pyrophosphate synthase 1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84012
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56681
Species: Hu, Mu, Rt, Rb, Sh
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP1-84975
Species: Hu
Applications: IHC, IHC-P
AF1440
Species: Mu
Applications: WB
NBP1-31475
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1936
Species: Hu
Applications: WB, IP
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-16984
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P
NBP1-33380
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Ha, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P, IP, KD, KO
MAB9350
Species: Hu
Applications: WB, IHC, IHC-P
H00001434-M08
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
8457-AS
Species: Hu
NBP2-54730
Species: Hu
Applications: IHC, IHC-P
NBP1-85500
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-86635
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Nogo B receptor Antibody (NBP2-85390) (0)

There are no publications for Nogo B receptor Antibody (NBP2-85390).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nogo B receptor Antibody (NBP2-85390) (0)

There are no reviews for Nogo B receptor Antibody (NBP2-85390). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nogo B receptor Antibody (NBP2-85390) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Nogo B receptor Products

Bioinformatics Tool for Nogo B receptor Antibody (NBP2-85390)

Discover related pathways, diseases and genes to Nogo B receptor Antibody (NBP2-85390). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nogo B receptor Antibody (NBP2-85390)

Discover more about diseases related to Nogo B receptor Antibody (NBP2-85390).
 

Pathways for Nogo B receptor Antibody (NBP2-85390)

View related products by pathway.

PTMs for Nogo B receptor Antibody (NBP2-85390)

Learn more about PTMs related to Nogo B receptor Antibody (NBP2-85390).
 

Research Areas for Nogo B receptor Antibody (NBP2-85390)

Find related products by research area.

Blogs on Nogo B receptor

There are no specific blogs for Nogo B receptor, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nogo B receptor Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUS1