Recombinant Human NOC3L Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human NOC3L Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 702-800 of Human NOC3L

Source: Wheat Germ

Amino Acid Sequence: PIVQRFAAHLIAGAPSEGSGALKPELSRRSATELFEAYSMAEMTFNPPVESSNPKIKGKFLQGDSFLNEDLNQLIKRYSSEVATESPLDFTKYLKTSLH

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
NOC3L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NOC3L Protein

  • AD24NOC3-like protein
  • C10orf117
  • chromosome 10 open reading frame 117
  • Factor for adipocyte differentiation 24
  • FAD24NOC3 protein homolog
  • FLJ12820
  • nucleolar complex associated 3 homolog (S. cerevisiae)
  • nucleolar complex protein 3 homolog
  • Nucleolar complex-associated protein 3-like protein

Background

NOC3L - chromosome 10 open reading frame 117

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92161
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western, IHC
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-16453
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NBP2-64688
Species: Hu
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00064318-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for NOC3L Partial Recombinant Protein (H00064318-Q01) (0)

There are no publications for NOC3L Partial Recombinant Protein (H00064318-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOC3L Partial Recombinant Protein (H00064318-Q01) (0)

There are no reviews for NOC3L Partial Recombinant Protein (H00064318-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NOC3L Partial Recombinant Protein (H00064318-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for NOC3L Partial Recombinant Protein (H00064318-Q01)

Discover related pathways, diseases and genes to NOC3L Partial Recombinant Protein (H00064318-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOC3L Partial Recombinant Protein (H00064318-Q01)

Discover more about diseases related to NOC3L Partial Recombinant Protein (H00064318-Q01).
 

Pathways for NOC3L Partial Recombinant Protein (H00064318-Q01)

View related products by pathway.

Research Areas for NOC3L Partial Recombinant Protein (H00064318-Q01)

Find related products by research area.

Blogs on NOC3L

There are no specific blogs for NOC3L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NOC3L Antibody
NBP2-55900

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NOC3L Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NOC3L