We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

NOA1 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related NOA1 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-81773PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NOA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NOA1.

Source: E. coli

Amino Acid Sequence: VLGNKVDLLPQDAPGYRQRLRERLWEDCARAGLLLAPGHQGPQRPVKDEPQDGENPNPPNWSRTVVRDVRLISAKTGYGV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NOA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81773.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NOA1 Recombinant Protein Antigen

  • chromosome 4 open reading frame 14
  • hAtNOS1
  • mAtNOS1
  • MGC3232
  • mitochondrial nitric oxide synthase
  • nitric oxide synthase, mitochondrial (putative)
  • putative ortholog of Arabidopsis mitochondrial nitric oxide synthase

Background

NOA1 is a gene that codes for a protein that is involved in the regulation of mitochondrial protein translation and respiration as well as mitochondria-mediated cell death, and is 698 amino acids long with a weight of approximately 78 kDa. Current research is being done on diseases and disorders related to this gene including pneumonia, adenocarcinoma, and malaria. NOA1 has also been shown to have interactions with AIFM1, GRB10, DAP3, HSPA8, and MPP3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00055791-B01P
Species: Hu
Applications: ICC/IF, WB
NB100-1586
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-88568
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-858
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, PEP-ELISA, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NBP1-26612
Species: Hu
Applications: IP (-), WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP1-83875
Species: Hu
Applications: IHC,  IHC-P
NBP3-46652
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP2-27084
Species: Hu, Pm
Applications: IHC,  IHC-P, WB
DCDL40
Species: Hu
Applications: ELISA
H00057410-M02
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
NBP1-87315
Species: Hu
Applications: IHC,  IHC-P
NB100-2832
Species: Hu
Applications: ELISA, IHC,  IHC-P
NBP2-45802
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for NOA1 Protein (NBP1-81773PEP) (0)

There are no publications for NOA1 Protein (NBP1-81773PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOA1 Protein (NBP1-81773PEP) (0)

There are no reviews for NOA1 Protein (NBP1-81773PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NOA1 Protein (NBP1-81773PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NOA1 Products

Blogs on NOA1

There are no specific blogs for NOA1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NOA1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NOA1