NOA1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

NOA1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NOA1.
  
  

  Source: E. coli

  Amino Acid Sequence: LVAEDIMLKEGLGASEAVADIKFSSAGWVSVTPNFKDRLHLRGYTPEGTVLTVRPPLLPYIVNIKGQRIKKSVAYKTKKPPSLMYNVRKKKGKIN

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: NOA1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81772.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NOA1 Recombinant Protein Antigen

• chromosome 4 open reading frame 14
• hAtNOS1
• mAtNOS1
• MGC3232
• mitochondrial nitric oxide synthase
• nitric oxide synthase, mitochondrial (putative)
• putative ortholog of Arabidopsis mitochondrial nitric oxide synthase

Background

NOA1 is a gene that codes for a protein that is involved in the regulation of mitochondrial protein translation and respiration as well as mitochondria-mediated cell death, and is 698 amino acids long with a weight of approximately 78 kDa. Current research is being done on diseases and disorders related to this gene including pneumonia, adenocarcinoma, and malaria. NOA1 has also been shown to have interactions with AIFM1, GRB10, DAP3, HSPA8, and MPP3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: NOA1