NOA1 Antibody

Images

 
Western Blot: NOA1 Antibody [NBP1-81773] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: NOA1 Antibody [NBP1-81773] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: NOA1 Antibody [NBP1-81773] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NOA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VLGNKVDLLPQDAPGYRQRLRERLWEDCARAGLLLAPGHQGPQRPVKDEPQDGENPNPPNWSRTVVRDVRLISAKTGYGV
Specificity
Specificity of human NOA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NOA1 Protein (NBP1-81773PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NOA1 Antibody

  • chromosome 4 open reading frame 14
  • hAtNOS1
  • mAtNOS1
  • MGC3232
  • mitochondrial nitric oxide synthase
  • nitric oxide synthase, mitochondrial (putative)
  • putative ortholog of Arabidopsis mitochondrial nitric oxide synthase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80834
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1586
Species: Hu
Applications: WB, IHC, IP
NB100-1032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66296
Species: Hu
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-37563
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-83875
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92354
Species: Hu
Applications: IHC, IHC-P
NBP2-30046
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NB100-2832
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP2-67791
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for NOA1 Antibody (NBP1-81773) (0)

There are no publications for NOA1 Antibody (NBP1-81773).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOA1 Antibody (NBP1-81773) (0)

There are no reviews for NOA1 Antibody (NBP1-81773). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NOA1 Antibody (NBP1-81773) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NOA1 Antibody (NBP1-81773)

Discover related pathways, diseases and genes to NOA1 Antibody (NBP1-81773). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOA1 Antibody (NBP1-81773)

Discover more about diseases related to NOA1 Antibody (NBP1-81773).
 

Pathways for NOA1 Antibody (NBP1-81773)

View related products by pathway.

PTMs for NOA1 Antibody (NBP1-81773)

Learn more about PTMs related to NOA1 Antibody (NBP1-81773).

Blogs on NOA1

There are no specific blogs for NOA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NOA1