NMNAT-2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

NMNAT-2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NMNAT-2
  
  

  Source: E.coli

  Amino Acid Sequence: TGRFIVIGGIVSPVHDSYGKQGLVSSRHRLIMCQLAVQNSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTPSMTPVIGQPQNETPQPIYQNSNVATKPTAAKILGKVGESLSRICCVRPPVERFTFVDENANLGTVM

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: NMNAT2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17903. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NMNAT-2 Recombinant Protein Antigen

• C1orf15
• chromosome 1 open reading frame 15
• EC 2.7.7.1
• EC 2.7.7.18
• KIAA0479MGC2756
• NaMN adenylyltransferase 2
• nicotinamide mononucleotide adenylyltransferase 2
• nicotinamide nucleotide adenylyltransferase 2
• Nicotinate-nucleotide adenylyltransferase 2
• NMN adenylyltransferase 2
• NMNAT2
• NMNAT-2
• PNAT2
• pyridine nucleotide adenylyltransferase 2

Background

Nicotinamide Nucleotide Adenylyltransferase 2 (NMNAT2) is a member of the nicotinamide mononucleotide adenylyltransferase (NMNAT) enzyme family. The NMNAT2 enzyme is located in the cytoplasm and is predominantly expressed in the brain; unlike other members of the NMNAT family which are ubiquitously expressed in the nucleus. NMNAT2 catalyzes the formation of NAD(+) from nicotinamide mononucleotide (NMN) and ATP. NMNAT2 will also catalyze the reverse reaction of pyrophosphorolytic cleavage of NAD(+).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: NMNAT2