NKX2.6 Antibody - BSA Free Summary
| Immunogen |
This antibody has been engineered to specifically recognize the recombinant protein NKX2.6 using the following amino acid sequence: LLSPVTSTPFSVKDILRLERERSCPAASPHPRVRKSPENFQYLRMDAEPRGSEVHNAGGGGGDRKLDGSE |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NKX2-6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
|
| Application Notes |
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for NKX2.6 Antibody - BSA Free
Background
Members of the NK-2 family of homeodomain proteins are key regulators of growth and development in several tissues, including brain, heart and pancreas.Nkx-2.5, also designated cardiac specific homeobox protein (Csx), is a homolog of the Drosophila tinman protein and is essential for normal cardiovascular development. Expression of Nkx-2.5 during cardiomyogenesis is required for cardiac septation, in which a single atrium and ventricle are separated into four chambers. Nkx-2.5 binds to DNA as a monomer, a homodimer or as a heterodimer with Nkx-2.3 or Nkx-2.6, which suggests that the specific protein-protein interactions of Nkx-2.5 are involved in its transcriptional regulatory function. Nkx-2.6, also a homolog of the Drosophila tinman protein, is expressed in the caudal pharyngeal pouches,the caudal heart progenitors, the sinus venosus, the outflow tract of the heart and in a short segment of the gut between stages E8.5 and E10.5 of embryogenesis. Expression of Nkx-2.6 overlaps with that of Nkx-2.5 in the pharynx and heart. However, Nkx-2.6 mutant mice are viable and fertile, which suggests that Nkx-2.6 plays a compensatory function to Nkx-2.5.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ChIP, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IP, WB
Species: Bv, Ca, Ch, Gp, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt, Sh, Xp
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Publications for NKX2.6 Antibody (NBP3-25018) (0)
There are no publications for NKX2.6 Antibody (NBP3-25018).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NKX2.6 Antibody (NBP3-25018) (0)
There are no reviews for NKX2.6 Antibody (NBP3-25018).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NKX2.6 Antibody (NBP3-25018) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NKX2.6 Products
Blogs on NKX2.6