Recombinant Human NKTR Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NKTR Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 888 - 984 of Human NKTR partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ESNSERDVTKNSKNDSHPSSDKEEGEATSDSESEVSEIHIKVKPTTKSSTNTSLPDDNGAWKSSKQRTSTSDSEGSCSNSENNRGKPQKHKHGSKEN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NKTR
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NKTR Protein

  • DKFZp686F1754
  • DKFZp686G0426
  • DKFZp686J06106
  • DKFZp686N24126
  • EC 5.2.1.8
  • MGC90527
  • natural killer triggering receptor
  • natural killer-tumor recognition sequence
  • Natural-killer cells cyclophilin-related protein
  • NK-TR protein
  • NK-tumor recognition protein
  • p104

Background

This gene encodes a membrane-anchored protein with a hydrophobic amino terminal domain and a cyclophilin-like PPIase domain. It is present on the surface of natural killer cells and facilitates their binding to targets. Its expression is regulated by IL2 activation of the cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46326
Species: Hu, Ca, Mk
Applications: WB, IHC, IF
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF3795
Species: Hu
Applications: WB, IP
AF5414
Species: Hu
Applications: WB, Simple Western
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NKTR Partial Recombinant Protein (H00004820-Q01) (0)

There are no publications for NKTR Partial Recombinant Protein (H00004820-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NKTR Partial Recombinant Protein (H00004820-Q01) (0)

There are no reviews for NKTR Partial Recombinant Protein (H00004820-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NKTR Partial Recombinant Protein (H00004820-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NKTR Products

NKTR H00004820-Q01

Bioinformatics Tool for NKTR Partial Recombinant Protein (H00004820-Q01)

Discover related pathways, diseases and genes to NKTR Partial Recombinant Protein (H00004820-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NKTR Partial Recombinant Protein (H00004820-Q01)

Discover more about diseases related to NKTR Partial Recombinant Protein (H00004820-Q01).
 

Pathways for NKTR Partial Recombinant Protein (H00004820-Q01)

View related products by pathway.

PTMs for NKTR Partial Recombinant Protein (H00004820-Q01)

Learn more about PTMs related to NKTR Partial Recombinant Protein (H00004820-Q01).

Blogs on NKTR

There are no specific blogs for NKTR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF
NKTR Antibody
NBP1-82459
IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NKTR Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NKTR