Recombinant Human NIRF Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human NIRF Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 81 - 180 of Human UHRF2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PGTSTQIEAKPCSNSPPKVKKAPRVGPSNQPSTSARARLIDPGFGIYKVNELVDARDVGLGAWFEAHIHSVTRASDGQSRGKTPLKNGSSCKRTNGNIKH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
UHRF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NIRF Protein

  • DKFZp434B0920
  • DKFZp686G0837
  • E3 ubiquitin-protein ligase UHRF2
  • EC 6.3.2
  • EC 6.3.2.-
  • MGC33463
  • NIRFUbiquitin-like-containing PHD and RING finger domains protein 2
  • Np95/ICBP90-like RING finger protein
  • Np95-like RING finger protein
  • Nuclear protein 97
  • Nuclear zinc finger protein Np97
  • RNF107RING finger protein 107
  • Ubiquitin-like PHD and RING finger domain-containing protein 2
  • ubiquitin-like with PHD and ring finger domains 2
  • ubiquitin-like, containing PHD and RING finger domains, 2
  • URF2

Background

UHRF2 - ubiquitin-like, containing PHD and RING finger domains, 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74597
Species: Hu
Applications: WB, IHC-P, IP
NBP1-92190
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP1-86312
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1219
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-37702
Species: Hu
Applications: WB, IP
NBP2-01232
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready

Publications for NIRF Partial Recombinant Protein (H00115426-Q01) (0)

There are no publications for NIRF Partial Recombinant Protein (H00115426-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NIRF Partial Recombinant Protein (H00115426-Q01) (0)

There are no reviews for NIRF Partial Recombinant Protein (H00115426-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NIRF Partial Recombinant Protein (H00115426-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NIRF Products

Bioinformatics Tool for NIRF Partial Recombinant Protein (H00115426-Q01)

Discover related pathways, diseases and genes to NIRF Partial Recombinant Protein (H00115426-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NIRF Partial Recombinant Protein (H00115426-Q01)

Discover more about diseases related to NIRF Partial Recombinant Protein (H00115426-Q01).
 

Pathways for NIRF Partial Recombinant Protein (H00115426-Q01)

View related products by pathway.

PTMs for NIRF Partial Recombinant Protein (H00115426-Q01)

Learn more about PTMs related to NIRF Partial Recombinant Protein (H00115426-Q01).
 

Research Areas for NIRF Partial Recombinant Protein (H00115426-Q01)

Find related products by research area.

Blogs on NIRF

There are no specific blogs for NIRF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NIRF Antibody (3A11)
H00115426-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NIRF Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UHRF2