Recombinant Human Niemann-Pick type C2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Niemann-Pick type C2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 52-151 of Human NPC2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NPC2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Niemann-Pick type C2 Protein

  • EDDM1
  • Epididymal Protein 1
  • epididymal secretory protein E1
  • HE1
  • HE1epididymal protein 1
  • Human epididymis-specific protein 1
  • MGC1333
  • Niemann-Pick disease type C2 protein
  • Niemann-Pick disease, type C2
  • NiemannPick Type C2
  • Niemann-Pick Type C2
  • NPC2
  • NP-C2
  • tissue-specific secretory protein

Background

This gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-52645
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, CyTOF-ready
NB100-56655
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP2-46360
Species: Hu
Applications: WB, IHC
NBP2-45889
Species: Hu
Applications: WB, IHC
AF1029
Species: Mu
Applications: WB, IHC, IP
NBP1-98296
Species: Hu
Applications: WB
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24950
Species: Hu, Mu, Rt
Applications: WB
NB400-128
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-02192
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC

Publications for Niemann-Pick type C2 Partial Recombinant Protein (H00010577-Q01) (0)

There are no publications for Niemann-Pick type C2 Partial Recombinant Protein (H00010577-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Niemann-Pick type C2 Partial Recombinant Protein (H00010577-Q01) (0)

There are no reviews for Niemann-Pick type C2 Partial Recombinant Protein (H00010577-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Niemann-Pick type C2 Partial Recombinant Protein (H00010577-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I'm looking for a Niemann-Pick type1 or 2 antibody to stain mouse heart section embedded in paraffin. I would like to label these sections with another primary antibody to show colocalisation of my protein of interest. I would like to know if you have a rabbit anti-Niemann-Pick antibody that works well for fluorescence immunohistochemistry?
    • Niemann-Pick C1 Antibody (NB400-148) (0.1 ml) is one of our best sellers and this antibody has been cited in at least 17 peer reviewed research publications in journals of high repute. We have only one Niemann-Pick type C2 antibody with catalog # H00010577-D01PInnovators Reward Program.

Additional Niemann-Pick type C2 Products

Bioinformatics Tool for Niemann-Pick type C2 Partial Recombinant Protein (H00010577-Q01)

Discover related pathways, diseases and genes to Niemann-Pick type C2 Partial Recombinant Protein (H00010577-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Niemann-Pick type C2 Partial Recombinant Protein (H00010577-Q01)

Discover more about diseases related to Niemann-Pick type C2 Partial Recombinant Protein (H00010577-Q01).
 

Pathways for Niemann-Pick type C2 Partial Recombinant Protein (H00010577-Q01)

View related products by pathway.

PTMs for Niemann-Pick type C2 Partial Recombinant Protein (H00010577-Q01)

Learn more about PTMs related to Niemann-Pick type C2 Partial Recombinant Protein (H00010577-Q01).

Blogs on Niemann-Pick type C2

There are no specific blogs for Niemann-Pick type C2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ABCA1 Antibody
NB400-105

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Niemann-Pick type C2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NPC2
Entrez