Recombinant Human Niemann-Pick type C2 GST (N-Term) Protein

SDS-Page: Recombinant Human Niemann-Pick type C2 Protein [H00010577-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human Niemann-Pick type C2 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 52-151 of Human Niemann-Pick type C2
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: GQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: NPC2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 36.74 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Niemann-Pick type C2 GST (N-Term) Protein

• EDDM1
• Epididymal Protein 1
• epididymal secretory protein E1
• HE1
• HE1epididymal protein 1
• Human epididymis-specific protein 1
• MGC1333
• Niemann-Pick disease type C2 protein
• Niemann-Pick disease, type C2
• NiemannPick Type C2
• Niemann-Pick Type C2
• NPC2
• NP-C2
• tissue-specific secretory protein

Background

This gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for Niemann-Pick type C2 Partial Recombinant Protein (H00010577-Q01). (Showing 1 - 1 of 1 FAQ).

1. I'm looking for a Niemann-Pick type1 or 2 antibody to stain mouse heart section embedded in paraffin. I would like to label these sections with another primary antibody to show colocalisation of my protein of interest. I would like to know if you have a rabbit anti-Niemann-Pick antibody that works well for fluorescence immunohistochemistry?
   • Niemann-Pick C1 Antibody (NB400-148) (0.1 ml) is one of our best sellers and this antibody has been cited in at least 17 peer reviewed research publications in journals of high repute. We have only one Niemann-Pick type C2 antibody with catalog # H00010577-D01PInnovators Reward Program.

Bioinformatics

• Gene Symbol: NPC2