Recombinant Human Niemann-Pick type C2 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Niemann-Pick type C2 Protein [H00010577-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related Niemann-Pick type C2 Peptides and Proteins

Order Details


    • Catalog Number
      H00010577-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Niemann-Pick type C2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 52-151 of Human Niemann-Pick type C2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
NPC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Niemann-Pick type C2 GST (N-Term) Protein

  • EDDM1
  • Epididymal Protein 1
  • epididymal secretory protein E1
  • HE1
  • HE1epididymal protein 1
  • Human epididymis-specific protein 1
  • MGC1333
  • Niemann-Pick disease type C2 protein
  • Niemann-Pick disease, type C2
  • NiemannPick Type C2
  • Niemann-Pick Type C2
  • NPC2
  • NP-C2
  • tissue-specific secretory protein

Background

This gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-148
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF1936
Species: Hu
Applications: IP, WB
NBP2-93935
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-75896
Species: Pm-Cm, Hu, RM
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vivo, WB
1787-MD
Species: Hu
Applications: Bind
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PCR, Simple Western, WB
DHE400
Species: Hu
Applications: ELISA
NBP2-45889
Species: Hu
Applications: IHC, IHC-Fr,  IHC-P, KD, WB
AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
NBP3-15588
Species: Mu, Rt
Applications: WB
AF2747
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NB500-526
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
NBP3-03965
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-24950
Species: Hu, Mu, Rt
Applications: WB
NB400-128
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-02192
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB

Publications for Niemann-Pick type C2 Partial Recombinant Protein (H00010577-Q01) (0)

There are no publications for Niemann-Pick type C2 Partial Recombinant Protein (H00010577-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Niemann-Pick type C2 Partial Recombinant Protein (H00010577-Q01) (0)

There are no reviews for Niemann-Pick type C2 Partial Recombinant Protein (H00010577-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Niemann-Pick type C2 Partial Recombinant Protein (H00010577-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I'm looking for a Niemann-Pick type1 or 2 antibody to stain mouse heart section embedded in paraffin. I would like to label these sections with another primary antibody to show colocalisation of my protein of interest. I would like to know if you have a rabbit anti-Niemann-Pick antibody that works well for fluorescence immunohistochemistry?
    • Niemann-Pick C1 Antibody (NB400-148) (0.1 ml) is one of our best sellers and this antibody has been cited in at least 17 peer reviewed research publications in journals of high repute. We have only one Niemann-Pick type C2 antibody with catalog # H00010577-D01PInnovators Reward Program.

Additional Niemann-Pick type C2 Products

Blogs on Niemann-Pick type C2

There are no specific blogs for Niemann-Pick type C2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Niemann-Pick type C2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NPC2