Niemann-Pick type C2 Antibody Summary
| Immunogen |
NPC2 (NP_006423.1, 1 a.a. - 151 a.a.) full-length human protein. MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL |
| Specificity |
NPC2 - Niemann-Pick disease, type C2, |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
NPC2 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactive against cell lysate and transfected lysate for western blot. It has also been used for ELISA. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Niemann-Pick type C2 Antibody
Background
This gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Pm-Cm, Hu, RM
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo, WB
Species: Hu
Applications: Bind
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
Species: Mu
Applications: ICC, IHC, IP, WB
Species: Mu, Rt
Applications: WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Publications for Niemann-Pick type C2 Antibody (H00010577-B01P)(1)
Showing Publication 1 -
1 of 1.
Reviews for Niemann-Pick type C2 Antibody (H00010577-B01P) (0)
There are no reviews for Niemann-Pick type C2 Antibody (H00010577-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Niemann-Pick type C2 Antibody (H00010577-B01P). (Showing 1 - 1 of 1 FAQ).
-
I'm looking for a Niemann-Pick type1 or 2 antibody to stain mouse heart section embedded in paraffin. I would like to label these sections with another primary antibody to show colocalisation of my protein of interest. I would like to know if you have a rabbit anti-Niemann-Pick antibody that works well for fluorescence immunohistochemistry?
- Niemann-Pick C1 Antibody (NB400-148) (0.1 ml) is one of our best sellers and this antibody has been cited in at least 17 peer reviewed research publications in journals of high repute. We have only one Niemann-Pick type C2 antibody with catalog # H00010577-D01PInnovators Reward Program.
Secondary Antibodies
| |
Isotype Controls
|
Additional Niemann-Pick type C2 Products
Blogs on Niemann-Pick type C2