Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody [Janelia Fluor® 669]

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Janelia Fluor 669

Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody [Janelia Fluor® 669] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 23-240 of human Nicotinic Acetylcholine R alpha 5/CHRNA5 (NP_000736.2).
  
  Sequence:
  RCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHRNA5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

Sold under license from the Howard Hughes Medical Institute, Janelia Research Campus.

Alternate Names for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody [Janelia Fluor® 669]

• Cholinergic receptor, neuronal nicotinic, alpha polypeptide-5
• cholinergic receptor, nicotinic, alpha 5
• cholinergic receptor, nicotinic, alpha polypeptide 5
• CHRNA5
• LNCR2
• NACHRA5
• neuronal acetylcholine receptor subunit alpha-5
• neuronal nicotinic acetylcholine receptor, alpha5 subunit
• Nicotinic Acetylcholine R alpha 5
• Nicotinic Acetylcholine Ra5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (NBP3-35746JF669). (Showing 1 - 1 of 1 FAQ).

1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
   • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Bioinformatics

• Gene Symbol: CHRNA5