Recombinant Human Nicotinic Acetylcholine R alpha 4/CHRNA4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Nicotinic Acetylcholine R alpha 4/CHRNA4 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human CHRNA4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CHRNA4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Nicotinic Acetylcholine R alpha 4/CHRNA4 Protein

  • nAchRa4
  • BFNC
  • cholinergic receptor, nicotinic, alpha 4
  • cholinergic receptor, nicotinic, alpha polypeptide 4
  • CHRNA4
  • EBN
  • EBN1
  • ENFL1
  • FLJ95812
  • nAChR alpha 4
  • NACHR
  • NACHRA4
  • NACRA4
  • neuronal acetylcholine receptor subunit alpha-4
  • neuronal nicotinic acetylcholine receptor alpha-4 subunit
  • Nicotinic Acetylcholine R alpha 4
  • Nicotinic Acetylcholine Ra4

Background

CHRNA4 - cholinergic receptor, nicotinic, alpha polypeptide 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP1-28467
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-88645
Species: Hu
Applications: IHC, IHC-P
NBP1-74102
Species: Mu, ChHa
Applications: WB
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-57262
Species: Hu
Applications: ICC/IF
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01) (0)

There are no publications for Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01) (0)

There are no reviews for Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
    • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Additional Nicotinic Acetylcholine R alpha 4/CHRNA4 Products

Bioinformatics Tool for Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01)

Discover related pathways, diseases and genes to Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01)

Discover more about diseases related to Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01).
 

Pathways for Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01)

View related products by pathway.

PTMs for Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01)

Learn more about PTMs related to Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01).
 

Research Areas for Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01)

Find related products by research area.

Blogs on Nicotinic Acetylcholine R alpha 4/CHRNA4

There are no specific blogs for Nicotinic Acetylcholine R alpha 4/CHRNA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Nicotinic Acetylcholine R alpha 4/CHRNA4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRNA4
Entrez