Recombinant Human Nicotinic Acetylcholine R alpha 4/CHRNA4 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human Nicotinic Acetylcholine R alpha 4/CHRNA4 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 29-128 of Human Nicotinic Acetylcholine R alpha 4/CHRNA4

Source: Wheat Germ (in vitro)

Amino Acid Sequence: HVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNN

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CHRNA4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Nicotinic Acetylcholine R alpha 4/CHRNA4 GST (N-Term) Protein

  • nAchRa4
  • BFNC
  • cholinergic receptor, nicotinic, alpha 4
  • cholinergic receptor, nicotinic, alpha polypeptide 4
  • CHRNA4
  • EBN
  • EBN1
  • ENFL1
  • FLJ95812
  • nAChR alpha 4
  • NACHR
  • NACHRA4
  • NACRA4
  • neuronal acetylcholine receptor subunit alpha-4
  • neuronal nicotinic acetylcholine receptor alpha-4 subunit
  • Nicotinic Acetylcholine R alpha 4
  • Nicotinic Acetylcholine Ra4

Background

CHRNA4 - cholinergic receptor, nicotinic, alpha polypeptide 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-28467
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-30052
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-38820
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-74102
Species: Ha, Mu
Applications: WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
H00001134-Q01
Species: Hu
Applications: ELISA, Flow, AP, PA, PAGE, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00001137-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01) (0)

There are no publications for Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01) (0)

There are no reviews for Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
    • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Additional Nicotinic Acetylcholine R alpha 4/CHRNA4 Products

Research Areas for Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01)

Find related products by research area.

Blogs on Nicotinic Acetylcholine R alpha 4/CHRNA4

There are no specific blogs for Nicotinic Acetylcholine R alpha 4/CHRNA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Nicotinic Acetylcholine R alpha 4/CHRNA4 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRNA4