Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human Nicotinic Acetylcholine R alpha 10/CHRNA10. Peptide sequence: GGLDAIRIPSSLVWRPDIVLYNKADAQPPGSASTNVVLRHDGAVRWDAPA The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CHRNA10 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody - BSA Free
Background
Ionotropic receptor with a probable role in the modulation of auditory stimuli. Agonist binding may induce an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The channel is permeable to a range of divalent cations including calcium, the influx of which may activate a potassium current which hyperpolarizes the cell membrane. In the ear, this may lead to a reduction in basilar membrane motion, altering the activity of auditory nerve fibers and reducing the range of dynamic hearing. This may protect against acoustic trauma
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, WB
Species: Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Rt
Applications: ELISA, Flow, WB
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC, IP, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, MiAr, WB
Species: Hu
Applications: WB
Publications for Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody (NBP2-86730) (0)
There are no publications for Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody (NBP2-86730).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody (NBP2-86730) (0)
There are no reviews for Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody (NBP2-86730).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody (NBP2-86730) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Nicotinic Acetylcholine R alpha 10/CHRNA10 Products
Research Areas for Nicotinic Acetylcholine R alpha 10/CHRNA10 Antibody (NBP2-86730)
Find related products by research area.
|
Blogs on Nicotinic Acetylcholine R alpha 10/CHRNA10