NICE-3 Antibody

Images

 
Western Blot: NICE-3 Antibody [NBP1-70653] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NICE-3 Antibody Summary

Immunogen
Synthetic peptides corresponding to C1ORF43 The peptide sequence was selected from the middle region of C1orf43. Peptide sequence YQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C1ORF43
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against C1orf43 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NICE-3 Antibody

  • chromosome 1 open reading frame 43
  • HCV NS5A-transactivated protein 4

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5458
Species: Hu
Applications: WB, ICC
NBP1-90276
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-23450
Species: Mu
NBP2-49394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83034
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92088
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-91797
Species: Hu
Applications: IHC, IHC-P
NBP1-80681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83254
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
NBP2-13963
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NICE-3 Antibody (NBP1-70653) (0)

There are no publications for NICE-3 Antibody (NBP1-70653).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NICE-3 Antibody (NBP1-70653) (0)

There are no reviews for NICE-3 Antibody (NBP1-70653). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NICE-3 Antibody (NBP1-70653) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NICE-3 Products

Bioinformatics Tool for NICE-3 Antibody (NBP1-70653)

Discover related pathways, diseases and genes to NICE-3 Antibody (NBP1-70653). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on NICE-3

There are no specific blogs for NICE-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NICE-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C1ORF43