Recombinant Human Nicastrin GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Nicastrin GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 16-115 of Human Nicastrin

Source: Wheat Germ (in vitro)

Amino Acid Sequence: VERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFS

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
NCSTN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Nicastrin GST (N-Term) Protein

  • anterior pharynx-defective 2
  • APH2
  • ATAG1874
  • KIAA0253APH2
  • NCSTN
  • Nicastrin

Background

NCSTN - nicastrin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-75632
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
NB100-74360
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
MAB931
Species: Hu, Mu
Applications: CyTOF-ready, IHC, ICFlow, WB
NB100-74513
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-90813
Species: Hu
Applications: IHC, IHC-P, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
H00004782-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP1-81000
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP1-81407
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15039
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
H00114799-T01
Species: Hu
Applications: WB

Publications for Nicastrin Partial Recombinant Protein (H00023385-Q01) (0)

There are no publications for Nicastrin Partial Recombinant Protein (H00023385-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nicastrin Partial Recombinant Protein (H00023385-Q01) (0)

There are no reviews for Nicastrin Partial Recombinant Protein (H00023385-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nicastrin Partial Recombinant Protein (H00023385-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nicastrin Products

Bioinformatics Tool for Nicastrin Partial Recombinant Protein (H00023385-Q01)

Discover related pathways, diseases and genes to Nicastrin Partial Recombinant Protein (H00023385-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nicastrin Partial Recombinant Protein (H00023385-Q01)

Discover more about diseases related to Nicastrin Partial Recombinant Protein (H00023385-Q01).
 

Pathways for Nicastrin Partial Recombinant Protein (H00023385-Q01)

View related products by pathway.

PTMs for Nicastrin Partial Recombinant Protein (H00023385-Q01)

Learn more about PTMs related to Nicastrin Partial Recombinant Protein (H00023385-Q01).
 

Research Areas for Nicastrin Partial Recombinant Protein (H00023385-Q01)

Find related products by research area.

Blogs on Nicastrin

There are no specific blogs for Nicastrin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Nicastrin GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NCSTN