NGL-1/LRRC4C Antibody - BSA Free

Western Blot: Netrin G1 ligand Antibody [NBP1-59669] - 293T cells lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NGL-1/LRRC4C Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to LRRC4C(leucine rich repeat containing 4C) The peptide sequence was selected from the N terminal of LRRC4C. Peptide sequence LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LRRC4C
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 72 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NGL-1/LRRC4C Antibody - BSA Free

• KIAA1580NGL-1NGL1Netrin-G1 ligand
• leucine rich repeat containing 4C
• leucine-rich repeat-containing protein 4C
• LRRC4C
• NGL1
• NGL-1

Background

NGL1 (LRRC4C) is a specific binding partner for netrin G1 (NTNG1), which is a member of the netrin family of axon guidance molecules. It may promote neurite outgrowth of developing thalamic neurons.NGL1 is a specific binding partner for netrin G1 (NTNG1; MIM 608818), which is a member of the netrin family of axon guidance molecules (Lin et al., 2003 [PubMed 14595443]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-528 AB046800.1 1-528 529-1824 AB046800.1 530-1825 1825-1827 BC041374.2 840-842 1828-1922 BC041374.2 844-938 1923-2926 BC041374.2 992-1995 2927-4054 AB046800.1 2928-4055

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LRRC4C
• Uniprot:
  • Q9HCJ2(Human)