NFX1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NFX1 Antibody [NBP2-58058] - Staining of human cell line SiHa shows localization to nucleus & cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NFX1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KELPCTSLKSEDATFMCDKRCNKKRLCGRHKCNEICCVDKEHKCPLICGRKLRCGLHRCEEPCHRGNCQTCWQASFDELTCHCGASVIYPPVPCGTRPPECTQTCARVHECDHPVYHSCHSEEKCPPCTFLTQKWC
Specificity
Specificity of human NFX1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NFX1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NFX1 Recombinant Protein Antigen (NBP2-58058PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NFX1 Antibody

  • DKFZp779G2416
  • EC 6.3.2.-
  • MGC20369
  • NFX2transcriptional repressor NF-X1
  • Nuclear transcription factor, X box-binding protein 1
  • nuclear transcription factor, X-box binding 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007337-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-317
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008615-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
H00004068-M01
Species: Hu, Mu
Applications: WB, ELISA, Flow, Func, S-ELISA
NBP1-30321
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP1-90179
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB600-335
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006428-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
NBP2-87382
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB120-5582
Species: Hu, Rt, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58058
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for NFX1 Antibody (NBP2-58058) (0)

There are no publications for NFX1 Antibody (NBP2-58058).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NFX1 Antibody (NBP2-58058) (0)

There are no reviews for NFX1 Antibody (NBP2-58058). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NFX1 Antibody (NBP2-58058) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NFX1 Products

Bioinformatics Tool for NFX1 Antibody (NBP2-58058)

Discover related pathways, diseases and genes to NFX1 Antibody (NBP2-58058). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NFX1 Antibody (NBP2-58058)

Discover more about diseases related to NFX1 Antibody (NBP2-58058).
 

Pathways for NFX1 Antibody (NBP2-58058)

View related products by pathway.

PTMs for NFX1 Antibody (NBP2-58058)

Learn more about PTMs related to NFX1 Antibody (NBP2-58058).
 

Research Areas for NFX1 Antibody (NBP2-58058)

Find related products by research area.

Blogs on NFX1

There are no specific blogs for NFX1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NFX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NFX1