NFIC Antibody (2B6)

Images

 
Western Blot: NFIC Antibody (2B6) [H00004782-M04] - Analysis of NFIC expression in Hela S3 NE (Cat # L013V3).
Sandwich ELISA: NFIC Antibody (2B6) [H00004782-M04] - Detection limit for recombinant GST tagged NFIC is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2B6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NFIC Antibody (2B6) Summary

Immunogen
NFIC (NP_005588 314 a.a. - 423 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TEDMEGGISSPVKKTEMDKSPFNSPSPQDSPRLSSFTQHHRPVIAVHSGIARSPHPSSALHFPTTSILPQTASTYFPHTAIRYPPHLNPQDPLKDLVSLACDPASQQPGP
Specificity
NFIC - nuclear factor I/C (CCAAT-binding transcription factor) (2B6)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NFIC
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NFIC Antibody (2B6)

  • CCAAT-binding transcription factor
  • CTF5
  • CTFCCAAT-box-binding transcription factor
  • MGC20153
  • NF1-C
  • NFI
  • NF-I
  • NF-I/C
  • NFI-C
  • nuclear factor 1 C-type
  • Nuclear factor 1/C
  • nuclear factor I/C (CCAAT-binding transcription factor)
  • Nuclear factor I/C
  • TGGCA-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-81406
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-81000
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004782-M04
Species: Hu
Applications: WB, ELISA

Publications for NFIC Antibody (H00004782-M04) (0)

There are no publications for NFIC Antibody (H00004782-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NFIC Antibody (H00004782-M04) (0)

There are no reviews for NFIC Antibody (H00004782-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NFIC Antibody (H00004782-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NFIC Products

Bioinformatics Tool for NFIC Antibody (H00004782-M04)

Discover related pathways, diseases and genes to NFIC Antibody (H00004782-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NFIC Antibody (H00004782-M04)

Discover more about diseases related to NFIC Antibody (H00004782-M04).
 

Pathways for NFIC Antibody (H00004782-M04)

View related products by pathway.

PTMs for NFIC Antibody (H00004782-M04)

Learn more about PTMs related to NFIC Antibody (H00004782-M04).
 

Research Areas for NFIC Antibody (H00004782-M04)

Find related products by research area.

Blogs on NFIC

There are no specific blogs for NFIC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NFIC Antibody (2B6) and receive a gift card or discount.

Bioinformatics

Gene Symbol NFIC
OMIM