Recombinant Human NF2/Merlin Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NF2/Merlin Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 82 of Human NF2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVVSLRALLLALRQKPHSTGTIHEVTAQLMMSVRLSFWPVAVCSCVAQMASFILIKAPPQPQQSPQPVLSTLLFMYLPGPAR

Protein/Peptide Type
Recombinant Protein
Gene
NF2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NF2/Merlin Protein

  • ACN
  • BANF
  • Merlin
  • moesin-ezrin-radixin like
  • Moesin-ezrin-radixin-like protein
  • moesin-ezrin-radizin-like protein
  • neurofibromin 2 (bilateral acoustic neuroma)
  • neurofibromin 2 (merlin)
  • neurofibromin-2
  • NF2
  • SCH
  • Schwannomerlin
  • Schwannomin

Background

Neurofibromin 2 (NF2) is a tumor suppressor gene encoding the protein Merlin. Merlin is closely related to the ERM (ezrin, radixin, moesin) family of proteins. The precise funtion of Merlin is not clear. It is thought to provide a link between the actin cytoskeleten and membrane associated proteins, playing a role in transduction of extracellular signals. It has been implicated in cell proliferation and cellular motility. Mutations in the NF2 gene cause neurofibromatosis type II, a condition characterised by the development of tumors in the central nervous system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB110-60017
Species: Mu, Rt, Bv(-), Ca(-), Hu(-), Po(-), Rb(-), Sh(-)
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-31553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-39474
Species: Hu, Mu, Rt, Po, Ca, GP, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)

Publications for NF2/Merlin Recombinant Protein (H00004771-P01) (0)

There are no publications for NF2/Merlin Recombinant Protein (H00004771-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NF2/Merlin Recombinant Protein (H00004771-P01) (0)

There are no reviews for NF2/Merlin Recombinant Protein (H00004771-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NF2/Merlin Recombinant Protein (H00004771-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NF2/Merlin Products

Bioinformatics Tool for NF2/Merlin Recombinant Protein (H00004771-P01)

Discover related pathways, diseases and genes to NF2/Merlin Recombinant Protein (H00004771-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NF2/Merlin Recombinant Protein (H00004771-P01)

Discover more about diseases related to NF2/Merlin Recombinant Protein (H00004771-P01).
 

Pathways for NF2/Merlin Recombinant Protein (H00004771-P01)

View related products by pathway.

PTMs for NF2/Merlin Recombinant Protein (H00004771-P01)

Learn more about PTMs related to NF2/Merlin Recombinant Protein (H00004771-P01).
 

Research Areas for NF2/Merlin Recombinant Protein (H00004771-P01)

Find related products by research area.

Blogs on NF2/Merlin

There are no specific blogs for NF2/Merlin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NF2/Merlin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NF2
Entrez