NF2/Merlin Recombinant Protein Antigen

Images

 
There are currently no images for NF2/Merlin Protein (NBP1-87757PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NF2/Merlin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NF2.

Source: E. coli

Amino Acid Sequence: ERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87757.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NF2/Merlin Recombinant Protein Antigen

  • ACN
  • BANF
  • Merlin
  • moesin-ezrin-radixin like
  • Moesin-ezrin-radixin-like protein
  • moesin-ezrin-radizin-like protein
  • neurofibromin 2 (bilateral acoustic neuroma)
  • neurofibromin 2 (merlin)
  • neurofibromin-2
  • NF2
  • SCH
  • Schwannomerlin
  • Schwannomin

Background

Merlin, also known as Neurofibromin 2 (NF2), is a tumor suppressor gene. Merlin is closely related to the ERM (ezrin, radixin, moesin) family of proteins. The precise function of Merlin is not clear. It is thought to provide a link between the actin cytoskeleten and membrane associated proteins, playing a role in transduction of extracellular signals. Merlin has been implicated in cell proliferation and cellular motility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89396
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP2-16213
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-16396
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC,  IHC-P, WB
NB300-155
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-32875
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
H00005962-M06
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP3-25443
Species: Hu, Mu, Rt
Applications: Flow, Func, ICC/IF, IHC,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP1-39474
Species: Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-87757PEP
Species: Hu
Applications: AC

Publications for NF2/Merlin Protein (NBP1-87757PEP) (0)

There are no publications for NF2/Merlin Protein (NBP1-87757PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NF2/Merlin Protein (NBP1-87757PEP) (0)

There are no reviews for NF2/Merlin Protein (NBP1-87757PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NF2/Merlin Protein (NBP1-87757PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NF2/Merlin Products

Research Areas for NF2/Merlin Protein (NBP1-87757PEP)

Find related products by research area.

Blogs on NF2/Merlin

There are no specific blogs for NF2/Merlin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NF2/Merlin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NF2