Neurotrypsin Recombinant Protein Antigen

Images

 
There are currently no images for Neurotrypsin Protein (NBP2-38231PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Neurotrypsin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRSS12.

Source: E. coli

Amino Acid Sequence: WVSVTDFGAPCLRWAEVPPFLERSPPASWAQLRGQRHNFCRSPDGAGRPWCFYGDARGKVDWGYCDCRHGSVRLRGGK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRSS12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38231.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Neurotrypsin Recombinant Protein Antigen

  • brain-specific serine protease 3
  • BSSP3
  • BSSP-3
  • EC 3.4.21
  • Leydin
  • MGC12722
  • Motopsin
  • MRT1EC 3.4.21.-
  • neurotrypsin
  • protease, serine, 12 (neurotrypsin, motopsin)
  • Serine protease 12

Background

Neurotrypsin is a central nervous system-expressed serine protease whose truncation or absence causes nonsyndromic mental retardation. It is most prominently expressed in structures that are involved in the processing and storage of learned behavior and memory, such as the cerebral cortex, the hippocampus, and amygdala. Evidence suggests that neurotrypsin has multiple functions, including axonal outgrowth, maintaining neuronal plasticity, and arranging the perineuronal environment, partly in coordination with other proteases including tissue plasminogen activator. There are three sequences published for neurotrypsin to date; 875, 834 and 505 amino acids in length. The predicted masses are 97, 92.5 and 55.7 kDa respectively, with predicted pI of 9.14, 8.88 and 6.57. The three forms all start at the same place. The 505 residue form terminates in the last SRCR domain, before the catalytic domain, and the 834 amino acid form has a 40 amino acid deletion that starts just after the PC site, and includes the catalytic histidine, thus both species would be proteolytically inactive.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

550-AG
Species: Rt
Applications: BA, BA
NBP1-91810
Species: Hu, Mu, Rt
Applications: ICC/IF, KD, KO, Simple Western, Single-Cell Western, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NB500-255
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF3587
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP1-82865
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-82018
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF2495
Species: Hu
Applications: IHC, IP, WB
NBP1-00248
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-14260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P
NBP1-20984
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, Simple Western, WB
DBD00
Species: Hu
Applications: ELISA
AF2008
Species: Hu
Applications: IHC, IP, WB
DTPA00
Species: Hu
Applications: ELISA
NB500-191
Species: Hu, Mu
Applications: IP, WB
AF6820
Species: Mu, Rt
Applications: IHC, WB
AF3565
Species: Mu
Applications: IHC, IP, WB

Publications for Neurotrypsin Protein (NBP2-38231PEP) (0)

There are no publications for Neurotrypsin Protein (NBP2-38231PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neurotrypsin Protein (NBP2-38231PEP) (0)

There are no reviews for Neurotrypsin Protein (NBP2-38231PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Neurotrypsin Protein (NBP2-38231PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Neurotrypsin Products

Research Areas for Neurotrypsin Protein (NBP2-38231PEP)

Find related products by research area.

Blogs on Neurotrypsin

There are no specific blogs for Neurotrypsin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Neurotrypsin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRSS12