Neurotrypsin Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRSS12. Source: E. coli
Amino Acid Sequence: GTVEVYASGVWGTVCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGLIPIYWSNVRCRGDEENILLCEKDIWQGGVCPQKMAAAVTCSFS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PRSS12 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89925. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Neurotrypsin Recombinant Protein Antigen
Background
Neurotrypsin is a central nervous system-expressed serine protease whose truncation or absence causes nonsyndromic mental retardation. It is most prominently expressed in structures that are involved in the processing and storage of learned behavior and memory, such as the cerebral cortex, the hippocampus, and amygdala. Evidence suggests that neurotrypsin has multiple functions, including axonal outgrowth, maintaining neuronal plasticity, and arranging the perineuronal environment, partly in coordination with other proteases including tissue plasminogen activator. There are three sequences published for neurotrypsin to date; 875, 834 and 505 amino acids in length. The predicted masses are 97, 92.5 and 55.7 kDa respectively, with predicted pI of 9.14, 8.88 and 6.57. The three forms all start at the same place. The 505 residue form terminates in the last SRCR domain, before the catalytic domain, and the 834 amino acid form has a 40 amino acid deletion that starts just after the PC site, and includes the catalytic histidine, thus both species would be proteolytically inactive.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Rt
Applications: BA, BA
Species: Hu, Mu, Rt
Applications: ICC/IF, KD, KO, Simple Western, Single-Cell Western, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IP, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Mu
Applications: IHC, IP, WB
Publications for Neurotrypsin Protein (NBP1-89925PEP) (0)
There are no publications for Neurotrypsin Protein (NBP1-89925PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Neurotrypsin Protein (NBP1-89925PEP) (0)
There are no reviews for Neurotrypsin Protein (NBP1-89925PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Neurotrypsin Protein (NBP1-89925PEP) (0)
Additional Neurotrypsin Products
Research Areas for Neurotrypsin Protein (NBP1-89925PEP)
Find related products by research area.
|
Blogs on Neurotrypsin