Neurotrypsin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Neurotrypsin Antibody [NBP1-89925] - Immunofluorescent staining of human cell line U-2 OS shows localization to actin filaments.
Immunohistochemistry-Paraffin: Neurotrypsin Antibody [NBP1-89925] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Neurotrypsin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GTVEVYASGVWGTVCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGLIPIYWSNVRCRGDEENILLCEKDIWQGGVCPQKMAAAVTCSFS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRSS12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Neurotrypsin Protein (NBP1-89925PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Neurotrypsin Antibody

  • brain-specific serine protease 3
  • BSSP3
  • BSSP-3
  • EC 3.4.21
  • Leydin
  • MGC12722
  • Motopsin
  • MRT1EC 3.4.21.-
  • neurotrypsin
  • protease, serine, 12 (neurotrypsin, motopsin)
  • Serine protease 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF550
Species: Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-91810
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
H00054862-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
H00006789-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PLA
NBP1-82018
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1928
Species: Mu
Applications: WB, IHC, IP
NBP2-48952
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14260
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-38263
Species: Hu
Applications: WB, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF2008
Species: Hu
Applications: WB, IHC, IP
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB500-191
Species: Hu, Mu
Applications: WB, IP, PLA
AF6820
Species: Mu, Rt
Applications: WB, IHC
AF3565
Species: Mu
Applications: WB, IHC, IP

Publications for Neurotrypsin Antibody (NBP1-89925) (0)

There are no publications for Neurotrypsin Antibody (NBP1-89925).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neurotrypsin Antibody (NBP1-89925) (0)

There are no reviews for Neurotrypsin Antibody (NBP1-89925). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Neurotrypsin Antibody (NBP1-89925) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neurotrypsin Products

Bioinformatics Tool for Neurotrypsin Antibody (NBP1-89925)

Discover related pathways, diseases and genes to Neurotrypsin Antibody (NBP1-89925). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neurotrypsin Antibody (NBP1-89925)

Discover more about diseases related to Neurotrypsin Antibody (NBP1-89925).
 

Pathways for Neurotrypsin Antibody (NBP1-89925)

View related products by pathway.

PTMs for Neurotrypsin Antibody (NBP1-89925)

Learn more about PTMs related to Neurotrypsin Antibody (NBP1-89925).
 

Research Areas for Neurotrypsin Antibody (NBP1-89925)

Find related products by research area.

Blogs on Neurotrypsin

There are no specific blogs for Neurotrypsin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neurotrypsin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRSS12