Neurofibromin 1 Recombinant Protein Antigen

Images

 
There are currently no images for Neurofibromin 1 Recombinant Protein Antigen (NBP3-25009PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Neurofibromin 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Neurofibromin 1

Source: E.coli

Amino Acid Sequence: MARRDDLSFCQEMKFRNKMVEYLTDWVMGTSNQAADDDV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
NF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25009It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Neurofibromin 1 Recombinant Protein Antigen

  • DKFZp686J1293
  • FLJ21220
  • Neurofibromatosis-related protein NF-1
  • neurofibromin 1
  • neurofibromin
  • NFNS
  • VRNF
  • WSS

Background

Neurofibromin 1 (NF1) is a suspected negative regulator of the ras signal transduction pathway. Neurofibromin is known to regulate the GTPase HRAS, causing the hydrolyzation and inactivation of GTP. Defects in NF1 lead to Neurofibromatosis disease, Recklinghausen disease or Watson disease. Neurofibromin has not been purified, therefore, most of the information regarding this protein has been deduced from homology analysis of its gene sequence.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-87757
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00200576-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, KD, S-ELISA, WB
AF5094
Species: Hu, Mu, Rt
Applications: WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-89945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB600-233
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC,  IHC-P, IP, WB
DPSG10
Species: Hu
Applications: ELISA
3047-CC
Species: Hu
Applications: BA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
H00004782-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB

Publications for Neurofibromin 1 Recombinant Protein Antigen (NBP3-25009PEP) (0)

There are no publications for Neurofibromin 1 Recombinant Protein Antigen (NBP3-25009PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neurofibromin 1 Recombinant Protein Antigen (NBP3-25009PEP) (0)

There are no reviews for Neurofibromin 1 Recombinant Protein Antigen (NBP3-25009PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Neurofibromin 1 Recombinant Protein Antigen (NBP3-25009PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Neurofibromin 1 Products

Research Areas for Neurofibromin 1 Recombinant Protein Antigen (NBP3-25009PEP)

Find related products by research area.

Blogs on Neurofibromin 1.

Developmental regulator Daam2 promotes glial cell tumors by degrading Von Hippel-Lindau protein
By Jamshed Arslan Pharm.D. Glioblastoma is an aggressive type of cancer that forms from the star-shaped glial cells of the central nervous system, called astrocytes. Intriguingly, several genes linked to glioblasto...  Read full blog post.

Neurofibromatosis Infographic
Neurofibromatosis (NF) is a genetic disorder caused by mutations in the NF1, NF2 or SMARCB1 genes which lead to tumor growth on nerves throughout the body. Although the tumors are usually benign, they still require chemotherapy to shrink and may becom...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Neurofibromin 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NF1