Neurofibromin 1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Neurofibromin 1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Neurofibromin 1
  
  

  Source: E.coli

  Amino Acid Sequence: MARRDDLSFCQEMKFRNKMVEYLTDWVMGTSNQAADDDV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: NF1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25009It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Neurofibromin 1 Recombinant Protein Antigen

• DKFZp686J1293
• FLJ21220
• Neurofibromatosis-related protein NF-1
• neurofibromin 1
• neurofibromin
• NFNS
• VRNF
• WSS

Background

Neurofibromin 1 (NF1) is a suspected negative regulator of the ras signal transduction pathway. Neurofibromin is known to regulate the GTPase HRAS, causing the hydrolyzation and inactivation of GTP. Defects in NF1 lead to Neurofibromatosis disease, Recklinghausen disease or Watson disease. Neurofibromin has not been purified, therefore, most of the information regarding this protein has been deduced from homology analysis of its gene sequence.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NF1