Recombinant Human Neurofibromin 1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Neurofibromin 1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 2719 - 2818 of Human NF1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DTYLPGIDEETSEESLLTPTSPYPPALQSQLSITANLNLSNSMTSLATSQHSPGIDKENVELSPTTGHCNSGRTRHGSASQVQKQRSAGSFKRNSIKKIV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NF1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00004763-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Neurofibromin 1 Protein

  • DKFZp686J1293
  • FLJ21220
  • Neurofibromatosis-related protein NF-1
  • neurofibromin 1
  • neurofibromin
  • NFNS
  • VRNF
  • WSS

Background

NF1 - neurofibromin 1 (neurofibromatosis, von Recklinghausen disease, Watson disease)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF5430
Species: Mu
Applications: WB, IP
H00200576-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF5094
Species: Hu, Mu, Rt
Applications: WB
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00004782-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
H00004763-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Neurofibromin 1 Partial Recombinant Protein (H00004763-Q01)(1)

Reviews for Neurofibromin 1 Partial Recombinant Protein (H00004763-Q01) (0)

There are no reviews for Neurofibromin 1 Partial Recombinant Protein (H00004763-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neurofibromin 1 Partial Recombinant Protein (H00004763-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Neurofibromin 1 Products

Bioinformatics Tool for Neurofibromin 1 Partial Recombinant Protein (H00004763-Q01)

Discover related pathways, diseases and genes to Neurofibromin 1 Partial Recombinant Protein (H00004763-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neurofibromin 1 Partial Recombinant Protein (H00004763-Q01)

Discover more about diseases related to Neurofibromin 1 Partial Recombinant Protein (H00004763-Q01).
 

Pathways for Neurofibromin 1 Partial Recombinant Protein (H00004763-Q01)

View related products by pathway.

PTMs for Neurofibromin 1 Partial Recombinant Protein (H00004763-Q01)

Learn more about PTMs related to Neurofibromin 1 Partial Recombinant Protein (H00004763-Q01).
 

Research Areas for Neurofibromin 1 Partial Recombinant Protein (H00004763-Q01)

Find related products by research area.

Blogs on Neurofibromin 1.

Neurofibromatosis Infographic
Neurofibromatosis (NF) is a genetic disorder caused by mutations in the NF1, NF2 or SMARCB1 genes which lead to tumor growth on nerves throughout the body. Although the tumors are usually benign, they still require chemotherapy to shrink and may becom...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Neurofibromin 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NF1