| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2719-2818 of Human Neurofibromin 1 Source: Wheat Germ (in vitro) Amino Acid Sequence: DTYLPGIDEETSEESLLTPTSPYPPALQSQLSITANLNLSNSMTSLATSQHSPGIDKENVELSPTTGHCNSGRTRHGSASQVQKQRSAGSFKRNSIKKIV |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | NF1 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
|
| Theoretical MW | 36.74 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Publication using H00004763-Q01 | Applications | Species |
|---|---|---|
| Kweh F, Zheng M, Kurenova E et al. Neurofibromin physically interacts with the N-terminal domain of focal adhesion kinase. Mol Carcinog 48(11):1005-17. 2009-11-01 [PMID: 19479903] |
Research Areas for Neurofibromin 1 Partial Recombinant Protein (H00004763-Q01)Find related products by research area.
|
|
Developmental regulator Daam2 promotes glial cell tumors by degrading Von Hippel-Lindau protein By Jamshed Arslan Pharm.D. Glioblastoma is an aggressive type of cancer that forms from the star-shaped glial cells of the central nervous system, called astrocytes. Intriguingly, several genes linked to glioblasto... Read full blog post. |
|
Neurofibromatosis Infographic Neurofibromatosis (NF) is a genetic disorder caused by mutations in the NF1, NF2 or SMARCB1 genes which lead to tumor growth on nerves throughout the body. Although the tumors are usually benign, they still require chemotherapy to shrink and may becom... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NF1 |