Recombinant Human NeuroD2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human NeuroD2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 266-375 of Human NeuroD2

Source: Wheat Germ

Amino Acid Sequence: RTHGYCAAYETLYAAAGGGGASPDYNSSEYEGPLSPPLCLNGNFSLKQDSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVRGGVHSENLLSYDMHLHHDRGPMYEE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
NEUROD2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NeuroD2 Protein

  • BHLHA1
  • bHLHa1neurogenic differentiation factor 2
  • Class A basic helix-loop-helix protein 1
  • MGC26304
  • NDRF
  • NDRFneurogenic basic-helix-loop-helix protein
  • NeuroD2
  • NeuroD-related factor
  • neurogenic differentiation 2

Background

This gene encodes a member of the neuroD family of neurogenic basic helix-loop-helix (bHLH) proteins. Expression of this gene can induce transcription from neuron-specific promoters, such as the GAP-43 promoter, which contain a specific DNA sequence known as an E-box. The product of the human gene can induce neurogenic differentiation in non-neuronal cells in Xenopus embryos, and is thought to play a role in the determination and maintenance of neuronal cell fates. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004760-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-29865
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
AF2567
Species: Mu
Applications: WB, IHC
NBP1-47871
Species: Hu, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-58800
Species: Hu
Applications: IHC, IHC-P
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
H00063973-M10
Species: Hu, Rt
Applications: WB, ELISA
AF4937
Species: Hu
Applications: WB, IHC
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NBP1-33581
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-66897
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-41305
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
H00000474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB7650
Species: Mu
Applications: WB, IHC
NBP2-27194
Species: Hu, Rt, Bv, Ch, Eq, Ha, Pm
Applications: WB, ICC/IF
H00004761-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for NeuroD2 Partial Recombinant Protein (H00004761-Q01) (0)

There are no publications for NeuroD2 Partial Recombinant Protein (H00004761-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NeuroD2 Partial Recombinant Protein (H00004761-Q01) (0)

There are no reviews for NeuroD2 Partial Recombinant Protein (H00004761-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NeuroD2 Partial Recombinant Protein (H00004761-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NeuroD2 Products

Bioinformatics Tool for NeuroD2 Partial Recombinant Protein (H00004761-Q01)

Discover related pathways, diseases and genes to NeuroD2 Partial Recombinant Protein (H00004761-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NeuroD2 Partial Recombinant Protein (H00004761-Q01)

Discover more about diseases related to NeuroD2 Partial Recombinant Protein (H00004761-Q01).
 

Pathways for NeuroD2 Partial Recombinant Protein (H00004761-Q01)

View related products by pathway.

PTMs for NeuroD2 Partial Recombinant Protein (H00004761-Q01)

Learn more about PTMs related to NeuroD2 Partial Recombinant Protein (H00004761-Q01).
 

Research Areas for NeuroD2 Partial Recombinant Protein (H00004761-Q01)

Find related products by research area.

Blogs on NeuroD2

There are no specific blogs for NeuroD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NeuroD2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NEUROD2
Entrez